Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate 8502259 DvMF_2969 ABC transporter related (RefSeq)
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__Miya:8502259 Length = 418 Score = 199 bits (507), Expect = 9e-56 Identities = 99/217 (45%), Positives = 140/217 (64%) Query: 21 VKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLYIGDRRVNDVPPKDRDIA 80 V D + +++ F +GPSGCGKTT LRMIAG E G + I R + + P R + Sbjct: 44 VNDVSFEVEQGRFFSILGPSGCGKTTLLRMIAGFESPDSGVIAIRGRDMAGIAPNRRPVN 103 Query: 81 MVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKILDIAHLLDRKPKALSGGQ 140 ++FQ+ AL+P M+V +N+AFGLK R + EI RRVQ+ + + + + P LSGGQ Sbjct: 104 LIFQHLALFPMMSVAENVAFGLKRRGMAGGEISRRVQDVLERVGLPGYGVKMPAQLSGGQ 163 Query: 141 RQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRLQTTVIYVTHDQTEAM 200 +QRVA+ R +V EP V L+DEPL LD KLR QM+ E++ L + TT +Y+THDQ+EA+ Sbjct: 164 KQRVAIARCLVLEPAVLLLDEPLGALDLKLREQMKVELKTLQAEVGTTFVYITHDQSEAL 223 Query: 201 TMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIG 237 M D + VM G +Q DTP+ +Y +P + FVAGF+G Sbjct: 224 VMSDHVAVMNAGRFEQVDTPRNLYRRPASAFVAGFVG 260 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 418 Length adjustment: 31 Effective length of query: 353 Effective length of database: 387 Effective search space: 136611 Effective search space used: 136611 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory