Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate 8500851 DvMF_1589 ABC transporter related (RefSeq)
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Miya:8500851 Length = 354 Score = 222 bits (566), Expect = 1e-62 Identities = 118/274 (43%), Positives = 174/274 (63%), Gaps = 20/274 (7%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M+ ++L N+ KR+ +V++ NL+I E +GPSGCGK+TTLRM+AG ED+ +G Sbjct: 1 MSYVRLVNVTKRFGGVT--AVDSLNLEIGRGECFSMLGPSGCGKTTTLRMVAGFEDLDDG 58 Query: 61 NLYIDDKLMNDAS------PKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINK 114 +++ D+L++ P+ RD MVFQ +A++PH+SVYEN+AF L++R+ +I++ Sbjct: 59 EIHVGDRLLSARRNNYYLPPEKRDFGMVFQAFAVWPHLSVYENVAFPLRIRRLSAAEIDR 118 Query: 115 RVHEAAEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAM 174 R EA L + ++ P DLSGG +QRVA+ RA+ + V L+DEPLS+LD LR M Sbjct: 119 RTREALHHTSLADVAQKSPDDLSGGGKQRVALARALAINPDVMLLDEPLSSLDPHLREEM 178 Query: 175 RAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELY 234 R EI + R G + +YVTHDQ+EAM L+DRI++M G ++Q+GTP ++Y Sbjct: 179 RFEIKDLQRTFGFSILYVTHDQSEAMALSDRIMVMRN----------GVVQQVGTPLDVY 228 Query: 235 NEPANKFVAGFIGSPAMNFFEVTVEKERLVNQDG 268 PAN FV GFIG NF +V + E LV +G Sbjct: 229 TNPANSFVFGFIG--LSNFLDVNLTPEGLVRVNG 260 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 354 Length adjustment: 30 Effective length of query: 347 Effective length of database: 324 Effective search space: 112428 Effective search space used: 112428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory