GapMind for catabolism of small carbon sources

 

Aligments for a candidate for thuK in Desulfovibrio vulgaris Miyazaki F

Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate 8501226 DvMF_1960 putrescine/spermidine ABC transporter ATPase protein (RefSeq)

Query= reanno::Smeli:SMc03065
         (362 letters)



>lcl|FitnessBrowser__Miya:8501226 DvMF_1960 putrescine/spermidine
           ABC transporter ATPase protein (RefSeq)
          Length = 399

 Score =  239 bits (611), Expect = 7e-68
 Identities = 119/244 (48%), Positives = 169/244 (69%), Gaps = 3/244 (1%)

Query: 6   LKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGE 65
           L+ + K++     +  IDL I+ GEF+  +GPSGCGK+T+LR+++G E+ T G++ I+G+
Sbjct: 10  LRGVTKTFEDTVALDSIDLTIRNGEFLTLLGPSGCGKTTILRLVSGFEQPTSGEVRINGQ 69

Query: 66  RVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTP 125
            VN VPP +R +  VFQ+YAL+PHMTV DN+AFG+++   + +E  RRV  A  M+ L  
Sbjct: 70  VVNRVPPEQRQVNTVFQNYALFPHMTVRDNVAFGLKMQGVAADETARRVLDALRMVHLEN 129

Query: 126 YLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSD 185
           + DR P+ LSGGQ+QRVAI RA+  NP V L DEP S LD  LR   ++EI  L +R   
Sbjct: 130 FADRKPRQLSGGQQQRVAIARAVINNPLVLLLDEPFSALDFKLRKQMQLEIKHL-QRQLG 188

Query: 186 TTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAMNVIPA 245
            T ++VTHDQ EA  ++DR+VV++ G IEQ+GAP E+YE PAN++VARF+G   +N +P 
Sbjct: 189 ITFVFVTHDQEEAFAMSDRVVVMNEGRIEQIGAPKEIYEEPANMYVARFVGD--INALPG 246

Query: 246 TITA 249
            I A
Sbjct: 247 RIDA 250


Lambda     K      H
   0.320    0.137    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 362
Number of extensions: 14
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 399
Length adjustment: 30
Effective length of query: 332
Effective length of database: 369
Effective search space:   122508
Effective search space used:   122508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory