Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate 8500851 DvMF_1589 ABC transporter related (RefSeq)
Query= TCDB::P54933 (332 letters) >FitnessBrowser__Miya:8500851 Length = 354 Score = 226 bits (576), Expect = 7e-64 Identities = 129/321 (40%), Positives = 184/321 (57%), Gaps = 29/321 (9%) Query: 1 MGKITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQI 60 M + L NV KRFG + SL+L+I GE +GPSGCGK+T LR++AG ED+ DG+I Sbjct: 1 MSYVRLVNVTKRFGGVTAVDSLNLEIGRGECFSMLGPSGCGKTTTLRMVAGFEDLDDGEI 60 Query: 61 MIDGRDATE------MPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRV 114 + R + +PP KR MVFQ++A++PH++V +N+AFPLR+ ++ EI+RR Sbjct: 61 HVGDRLLSARRNNYYLPPEKRDFGMVFQAFAVWPHLSVYENVAFPLRIRRLSAAEIDRRT 120 Query: 115 SNAAKILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRL 174 A +L + + P LSGG +QRVA+ RA+ P L DEPLS+LD LR MR Sbjct: 121 REALHHTSLADVAQKSPDDLSGGGKQRVALARALAINPDVMLLDEPLSSLDPHLREEMRF 180 Query: 175 EITELHQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFI 234 EI +L ++ +++YVTHDQ EAM ++D+I+V+ G ++QVG+PL +Y NPAN FV GFI Sbjct: 181 EIKDLQRTFGFSILYVTHDQSEAMALSDRIMVMRNGVVQQVGTPLDVYTNPANSFVFGFI 240 Query: 235 GSPK---MNL-------IEGPEA------------AKHGATTIGIRPEHIDLSREAGAWE 272 G +NL + G +A G + RP ID + E G Sbjct: 241 GLSNFLDVNLTPEGLVRVNGGDARVTPATPPSARLVSAGRAALASRPSEIDFTAEGGL-R 299 Query: 273 GEVGVSEHLGSDTFLHVHVAG 293 G V +LG + V+G Sbjct: 300 GVVRRRAYLGEIVDYRIDVSG 320 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 354 Length adjustment: 29 Effective length of query: 303 Effective length of database: 325 Effective search space: 98475 Effective search space used: 98475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory