Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate 8501378 DvMF_2110 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__Miya:8501378 Length = 316 Score = 207 bits (528), Expect = 2e-58 Identities = 115/320 (35%), Positives = 182/320 (56%), Gaps = 22/320 (6%) Query: 14 FHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRN-GRIVDGEAIFL 72 F +++AVDG+S L++G +LG+VGESG GKS ++ L+ + G+++ +F Sbjct: 2 FDPTPAVLRAVDGVSLTLDRGRTLGLVGESGCGKSTLARMVVGLLPPSAGQVLLDGRLFA 61 Query: 73 GKDL-------------LKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIW 119 G D L +++ E + + ++FQ+P +SLNP VG + E + Sbjct: 62 GTDGDAANGGASGHSADLAISRAEAAQL----VQMVFQDPFSSLNPRRTVGASIGEALAV 117 Query: 120 HRLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIAD 179 + E R + ++L+ VG+ + YP +FSGG RQRV +A AL HP L++ D Sbjct: 118 AGV-PGPERRAKVADMLQLVGL--RAEHADRYPHEFSGGQRQRVAVARALITHPALVVCD 174 Query: 180 EPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPV 239 EP ++LD ++QAQ++ LL+EL+E G++ +FI+HDL V + D + MY GK+VEEAP Sbjct: 175 EPVSSLDASVQAQVLNLLRELQEHMGLAYLFISHDLGVVGHMSDHVAVMYLGKVVEEAPR 234 Query: 240 EEILKTPLHPYTKGLLNST-LEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEIC 298 + + P HPYT+ LL S + SR + + G+ P+P P GC FHPRC M++C Sbjct: 235 DVLFAAPAHPYTRALLASVPVRDPSRRAEHPALSGDLPSPIAPPPGCPFHPRCPQVMDVC 294 Query: 299 QREEPPLVNISENHRVACHL 318 +R+ P ++E CHL Sbjct: 295 RRQVPGWHVVAEGQHARCHL 314 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 316 Length adjustment: 28 Effective length of query: 296 Effective length of database: 288 Effective search space: 85248 Effective search space used: 85248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory