Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate 8502321 DvMF_3029 ABC transporter related (RefSeq)
Query= SwissProt::Q9F9B0 (260 letters) >FitnessBrowser__Miya:8502321 Length = 537 Score = 122 bits (305), Expect = 2e-32 Identities = 77/223 (34%), Positives = 123/223 (55%), Gaps = 11/223 (4%) Query: 5 PILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIR 64 P++ G+ K +G+V A D+ PG I A++G+NGAGKS+++ ++G + D G I Sbjct: 28 PVVRLDGICKSFGKVRANHDITLDIRPGCIKALLGENGAGKSTLMSILAGKLRQDAGTIV 87 Query: 65 LEGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDRA 124 ++G P F SP +A +AGI VYQ+ L ++++A+N+ LG + P ++ L A Sbjct: 88 VDGVPTVFASPRDALRAGIGMVYQHFMLVDSMTVAENVLLG---QSPDML------LRPA 138 Query: 125 AMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGV 184 M + A GL + V LS G+RQ V + + S+V+I+DEPTA L Sbjct: 139 RMRDEVAALAERYGLAV--DPAARVGGLSMGERQRVEILKLLYRDSRVLILDEPTAVLTP 196 Query: 185 KESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLG 227 +E+ ++ E + + +G +V ISH + V VAD I I R G Sbjct: 197 RETDQLFEAMWRMADQGKALVFISHKLQEVLTVADEIAILRRG 239 Score = 73.6 bits (179), Expect = 8e-18 Identities = 61/226 (26%), Positives = 99/226 (43%), Gaps = 12/226 (5%) Query: 32 GEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRLEGKPIQ--FRSPMEAR-QAGIETVYQ 88 GEI+A+ G G G+ +++AI G P+ GE+R+ G+P + F P R A I Q Sbjct: 301 GEIVAIAGVAGNGQKELVEAICGLARPEAGEVRILGRPWREFFAGPPGRRGLAYIPEDRQ 360 Query: 89 NLALSPALSIADNMFL-GREIRKPGIMGKWFRSLDRAAMEKQARAKLSELGLMTIQNINQ 147 LA L + DN L R G+ LDR + + E + +I Sbjct: 361 GLATCRHLDLVDNFLLTTRNQFAKGVF------LDRTEATNAVKRVVWEYNVQP-GDITA 413 Query: 148 AVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRRVLELILDVRRRGLPIVLI 207 LSGG Q + + R +V++ + PT L + + V +L+ R ++L+ Sbjct: 414 PARALSGGNLQKLVIGREFFRKPEVIVAENPTQGLDISATEEVWGRLLEARSTS-GVLLV 472 Query: 208 SHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMSDAVAFMTGAKEP 253 + ++ E+ADRI + GR + V + D A+ M P Sbjct: 473 TGDLNEALELADRIAVMYRGRFIDVFDKDDTAKVQAIGLMMAGVRP 518 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 260 Length of database: 537 Length adjustment: 30 Effective length of query: 230 Effective length of database: 507 Effective search space: 116610 Effective search space used: 116610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory