Align BadH (characterized)
to candidate 8502147 DvMF_2858 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__Miya:8502147 Length = 245 Score = 124 bits (312), Expect = 1e-33 Identities = 80/245 (32%), Positives = 118/245 (48%), Gaps = 8/245 (3%) Query: 7 KTAVITGGGGGIGGATCRRFAQEGAKIAV-FDLNLDAAEKVAGAIRDAGGTAEAVRCDIA 65 + A++TGG GIG A R AQ+G + V + N AA +V AI GG A AV D+ Sbjct: 6 RNAIVTGGSRGIGRAIALRLAQDGFCVVVNYASNAPAALEVVDAIARTGGQAVAVPADVG 65 Query: 66 DRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHHAV 125 + V+ A G V ++VN+AG P + +E+++ NLTG ++ Sbjct: 66 ETGDVEGLFAAAHDAFGQVGVVVNSAGIMPMLPIAGGDTAAFEKVLRTNLTGTFNVLSRA 125 Query: 126 LPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVVCP 185 + GRI+ +++ G Y A K G+ + LA E ITVN V P Sbjct: 126 ANALT--AGGRIIALSTSVIAKPFPGYGPYIASKAGVEGLVRVLANELRGRSITVNAVAP 183 Query: 186 GPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQVL 245 GP T L + E+ I A K PL RLG P+++AG ++F + G+I QV+ Sbjct: 184 GPVATDLFLN-----GKTEEQIAAIGKLAPLERLGTPEEIAGVVSFLVGPEGGWINAQVV 238 Query: 246 SVSGG 250 V+GG Sbjct: 239 RVNGG 243 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 245 Length adjustment: 24 Effective length of query: 231 Effective length of database: 221 Effective search space: 51051 Effective search space used: 51051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory