Align benzoyl-CoA reductase (EC 1.3.7.8) (characterized)
to candidate 8500230 DvMF_0987 CoA-substrate-specific enzyme activase (RefSeq)
Query= BRENDA::Q8VUG0 (301 letters) >FitnessBrowser__Miya:8500230 Length = 269 Score = 176 bits (446), Expect = 5e-49 Identities = 93/254 (36%), Positives = 157/254 (61%), Gaps = 6/254 (2%) Query: 38 ITCGIDVGSVSSQAVLV--CDGELYGYNSMRTGNNSPDSAKNALQGIMDKIGMKLEDINY 95 + G+DVGS +++AV++ + G TG N ++ + L + + G ++ + Sbjct: 6 LVAGVDVGSTAAKAVVLDTASRAVLGVAVTPTGWNPRETGQAVLDAALREAGTGIDRVAR 65 Query: 96 VVGTGYGRVNVPFAHKAITEIACHARGANYMGGNKVRTILDMGGQDCKAIHCDDKGKVTN 155 VVGTGYGR+++PF H+ +TEI CHARGA ++ + RT+LD+GGQD K + D++G V + Sbjct: 66 VVGTGYGRISLPFLHRTVTEITCHARGAQHLAPD-TRTVLDVGGQDSKVVAVDERGNVRD 124 Query: 156 FLMNDKCAAGTGRGMEVISDLMQIPIAELGPRSFDVETEPEAVSSICVVFAKSEALGLLK 215 F+MNDKCAAGTGR ++V++ ++ + + E+G + + P ++S+C VFA++E +GL+ Sbjct: 125 FVMNDKCAAGTGRFLQVMTGVLDMTLDEMGDAA--LRGTPVPLNSMCAVFAETEVIGLIA 182 Query: 216 AGYTKNMVIAAYCQAMAERVVSLLERIGVEEGFFITGGIAKNPGVVKRIERLLGIKQLET 275 G +K+ + A+ ++A R+ +L R+ + G TGG+A NP + LG+ + Sbjct: 183 QGVSKDDLAASIVASVARRLKALTGRVPLVPGCAFTGGLATNPAFARIFSDTLGLAVTVS 242 Query: 276 KIDSQIAGALGAAL 289 + Q GALGAAL Sbjct: 243 DM-PQATGALGAAL 255 Lambda K H 0.318 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 269 Length adjustment: 26 Effective length of query: 275 Effective length of database: 243 Effective search space: 66825 Effective search space used: 66825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory