Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate 8500740 DvMF_1483 inner-membrane translocator (RefSeq)
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__Miya:8500740 Length = 295 Score = 196 bits (497), Expect = 7e-55 Identities = 108/297 (36%), Positives = 167/297 (56%), Gaps = 18/297 (6%) Query: 6 QQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQVAPGLP 65 Q ++GL GS+YAL+ALGY++++ ++NF GD L +G +V SLL V+ GLP Sbjct: 11 QYTLSGLTTGSVYALLALGYSLIFNATGIVNFTQGDFLSLGGLVLYSLL-----VSQGLP 65 Query: 66 GIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAMMIWGR 125 +V A I V + L+ER+ RP R+ + + + S L++ L WG+ Sbjct: 66 ----IVAAFPATILVVALAGALVERVCLRPARSRQMIILIFITMAASTLMRGLMKEGWGK 121 Query: 126 SPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMRATAENPR 185 PL P + P P + GA+++P + ++ + + + L T G+AMRA A +PR Sbjct: 122 LPLALPPLSPEVPFRLLGAVLTPQNLWVMGMTLCGIAALAWFFRATVTGKAMRAAAADPR 181 Query: 186 IAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSAAVLGGIG 245 A LMGV+ ++ ++FA L A+ G M ++ + +G + GLK F+AAVLGG G Sbjct: 182 TARLMGVEVERLTTLSFAFAGALGALGG-MLITPITSLSYDIGLMLGLKGFAAAVLGGYG 240 Query: 246 NIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPSGIMG 302 + GA+ GG+LLGL ES GAGY+ S Y+D+ F +LI+VL +RP G+ G Sbjct: 241 SFAGAVAGGVLLGLFESYGAGYV--------TSAYRDVLVFGLLILVLFVRPQGLFG 289 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 295 Length adjustment: 27 Effective length of query: 282 Effective length of database: 268 Effective search space: 75576 Effective search space used: 75576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory