Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate 8500738 DvMF_1481 ABC transporter related (RefSeq)
Query= uniprot:D8J1T6 (255 letters) >FitnessBrowser__Miya:8500738 Length = 259 Score = 232 bits (591), Expect = 7e-66 Identities = 113/251 (45%), Positives = 163/251 (64%) Query: 4 TLLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFE 63 TLL +RD+S FGG++AL+ T + G I LIGPNGAGKTT N +TG+ +PD+G Sbjct: 2 TLLAVRDLSVAFGGIRALDAASFTAQAGAITALIGPNGAGKTTLVNCVTGMVRPDSGNVA 61 Query: 64 LDGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAA 123 DG+ + A H + + G+ARTFQ++R+FG M++LENVMVG H + + ++ R Sbjct: 62 FDGRDITGMAAHRLPRLGLARTFQHLRVFGSMSLLENVMVGLHGHVRTGMLSSMLRLPGV 121 Query: 124 REEEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAG 183 R E A+R+ + + LDF G+ A A L YGDQ+RL +ARAL DP+++ LDEP AG Sbjct: 122 RRTERAMRDAAMRALDFTGLADRADGAAGLLPYGDQKRLVLARALVGDPRMILLDEPVAG 181 Query: 184 MNATEKLGLRELLVKIQAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQKN 243 +N E + L++ ++A G +LLIEHD+ L+M + + + VL G IAEG P +V++N Sbjct: 182 LNPAETHEMGGLILALRARGVAVLLIEHDMSLVMRVSDAVVVLCSGAKIAEGAPGEVKRN 241 Query: 244 PAVIEAYLGAG 254 P V+ AYLG G Sbjct: 242 PEVVNAYLGGG 252 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 259 Length adjustment: 24 Effective length of query: 231 Effective length of database: 235 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory