Align BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized)
to candidate 8500851 DvMF_1589 ABC transporter related (RefSeq)
Query= TCDB::Q93A35 (328 letters) >FitnessBrowser__Miya:8500851 Length = 354 Score = 176 bits (445), Expect = 1e-48 Identities = 98/265 (36%), Positives = 154/265 (58%), Gaps = 13/265 (4%) Query: 2 IRFDNVSKKYSDDKTAAVNNVTLDIKDGEFFVFIGPSGCGKTTTLKMINRLIPLTTGTIY 61 +R NV+K++ AV+++ L+I GE F +GPSGCGKTTTL+M+ L G I+ Sbjct: 4 VRLVNVTKRFGG--VTAVDSLNLEIGRGECFSMLGPSGCGKTTTLRMVAGFEDLDDGEIH 61 Query: 62 INEKRIS----DYDIHELRWDIGYVLQQIALFPHMTIEENIAIVPELKKWSKEKIHDRIT 117 + ++ +S +Y + + D G V Q A++PH+++ EN+A +++ S +I R Sbjct: 62 VGDRLLSARRNNYYLPPEKRDFGMVFQAFAVWPHLSVYENVAFPLRIRRLSAAEIDRRTR 121 Query: 118 ELLDSVGLDPESYRHRKPAELSGGEQQRVGVVRALAADPGIILMDEPFSALDPISRQRLQ 177 E L L + P +LSGG +QRV + RALA +P ++L+DEP S+LDP R+ ++ Sbjct: 122 EALHHTSL--ADVAQKSPDDLSGGGKQRVALARALAINPDVMLLDEPLSSLDPHLREEMR 179 Query: 178 QDISALQKKIKKTIVFVTHDMQEALALGDRICVMQGGEIVQVATPQEIMKNPENDFVKDF 237 +I LQ+ +I++VTHD EA+AL DRI VM+ G + QV TP ++ NP N FV F Sbjct: 180 FEIKDLQRTFGFSILYVTHDQSEAMALSDRIMVMRNGVVQQVGTPLDVYTNPANSFVFGF 239 Query: 238 LASGHAFNTPILEANFTVNDLIEAD 262 + + L+ N T L+ + Sbjct: 240 IGLSN-----FLDVNLTPEGLVRVN 259 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 354 Length adjustment: 28 Effective length of query: 300 Effective length of database: 326 Effective search space: 97800 Effective search space used: 97800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory