GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Desulfovibrio vulgaris Miyazaki F

Align Acyl-coenzyme A synthetase ACSM3, mitochondrial; Acyl-CoA synthetase medium-chain family member 3; Butyrate--CoA ligase 3; Butyryl-coenzyme A synthetase 3; Middle-chain acyl-CoA synthetase 3; Propionate--CoA ligase; Protein SA homolog; EC 6.2.1.2; EC 6.2.1.17 (characterized)
to candidate 8499218 DvMF_0003 AMP-dependent synthetase and ligase (RefSeq)

Query= SwissProt::Q3UNX5
         (580 letters)



>lcl|FitnessBrowser__Miya:8499218 DvMF_0003 AMP-dependent synthetase
           and ligase (RefSeq)
          Length = 557

 Score =  444 bits (1143), Expect = e-129
 Identities = 226/548 (41%), Positives = 335/548 (61%), Gaps = 16/548 (2%)

Query: 36  NYESMKQDFKIEIPEYFNFAKDVLDQWTNMEKAGKRLSNPAFWWIDGNGEELRWSFEELG 95
           +Y+     F+I+ P+ FNFA DVLD     +     +++     +D  G    ++F  + 
Sbjct: 11  DYKEFCATFRIDAPDTFNFAFDVLDPIAAADPGRLCIAH-----VDDAGVRRDYTFAWMA 65

Query: 96  LLSRKFANILTEACSLQRGDRVMVILPKIPEWWLANVACLRTGTVLIPGTTQLTQKDILY 155
             S K AN L     +++GDRVM++L +  E+W++ +A  R G V IP   QLT KDI++
Sbjct: 66  EASAKLANAL-RLRGIRKGDRVMLVLYRRIEFWVSMLALHRLGAVAIPAPAQLTPKDIVF 124

Query: 156 RLQSSKAKCIITDDTLAPAVDAVAAKCENLHSKLIVSQHSR-EGWGNLKEMMKYASDSHT 214
           R++ +K +C+I D ++   V+A    C  L   + V   +   GW +   +   A     
Sbjct: 125 RVERAKTRCVIVDHSITERVEAARPDCPGLAVCVQVGGDALPRGWVDYDTIFTPAEARFP 184

Query: 215 CVDTK-----HDEMMAIYFTSGTTGPPKMIGHTHSSFGLGLSVNGRFWLDLIASDVMWNT 269
             ++       ++ + I+F+SGTTG PKM+ H H+ + LG  + G +W DL+  D+    
Sbjct: 185 RPESPLEFAGGEDPLLIFFSSGTTGMPKMVEHVHT-YPLGHLLTGMYWHDLVPGDLHLTL 243

Query: 270 SDTGWAKSAWSSVFSPWTQGACVFAH-YLPRFESTSILQTLSKFPITVFCSAPTAYRMLV 328
           +DTGW K+ W   +  W  GA VF + +  +FE  ++L  L+   +T FC+ PT YR LV
Sbjct: 244 ADTGWGKAVWGKFYGQWMAGASVFVYDFRGKFEPAALLDVLAAHAVTTFCAPPTVYRFLV 303

Query: 329 QNDMSSYKFNSLKHCVSAGEPINPEVMEQWRKKTGLDIYEGYGQTETVLICGNFKGMKIK 388
           + D+S+Y  + L+HC +AGE +N  V   W+  TGL+I+EGYGQTET L       M  K
Sbjct: 304 RQDLSAYDLSKLRHCTTAGELLNDSVFHDWKAATGLEIHEGYGQTETTLQIATLPCMTPK 363

Query: 389 PGSMGKPSPAFDVKILDENGATLPPGQEGDIALQVLPERPFGLFTHYVDNPSKTASTLRG 448
            GS+G+P P +DV + D  G   PPG+EG+I ++V    P GLF  Y++ P KTAS + G
Sbjct: 364 AGSIGRPMPGWDVVLQDAAGNICPPGEEGEICVRVAEGLPVGLFRGYLEEPEKTASVMFG 423

Query: 449 SFYITGDRGYMDEDGYFWFVARSDDIILSSGYRIGPFEVESALIEHPSIAESAVVSSPDP 508
            +Y TGD+ +MDEDGY+WF+ R DD+I SSGYRIGPFEVESAL+ HP++ E+AV   PDP
Sbjct: 424 GYYHTGDKAWMDEDGYYWFLGRVDDLIKSSGYRIGPFEVESALVAHPAVVEAAVTGVPDP 483

Query: 509 IRGEVVKAFIVLNPDYKSHDQEQLKKEIQEHVKKTTAPYKYPRKVEFIEELPKTVSGKVK 568
           +RG+ VKA +VL   Y + D   L KE+Q+HVKK TAPYKYPR ++++ ELPKT+SGK+K
Sbjct: 484 LRGQAVKATVVLAAGYTASD--ALTKELQDHVKKVTAPYKYPRIIDYVAELPKTISGKIK 541

Query: 569 RNELRKKE 576
           R E+R+++
Sbjct: 542 RAEIRERD 549


Lambda     K      H
   0.319    0.134    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 892
Number of extensions: 29
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 580
Length of database: 557
Length adjustment: 36
Effective length of query: 544
Effective length of database: 521
Effective search space:   283424
Effective search space used:   283424
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory