GapMind for catabolism of small carbon sources

 

Aligments for a candidate for potA in Desulfovibrio vulgaris Miyazaki F

Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate 8501226 DvMF_1960 putrescine/spermidine ABC transporter ATPase protein (RefSeq)

Query= CharProtDB::CH_024626
         (378 letters)



>lcl|FitnessBrowser__Miya:8501226 DvMF_1960 putrescine/spermidine
           ABC transporter ATPase protein (RefSeq)
          Length = 399

 Score =  382 bits (980), Expect = e-110
 Identities = 202/391 (51%), Positives = 261/391 (66%), Gaps = 32/391 (8%)

Query: 17  LVQLAGIRKCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIML 76
           +++L G+ K F+    +  +DLTI NGEFLTLLGPSGCGKTT+LRL++G E   SG + +
Sbjct: 7   IIELRGVTKTFEDTVALDSIDLTIRNGEFLTLLGPSGCGKTTILRLVSGFEQPTSGEVRI 66

Query: 77  DNEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQ 136
           + + +  VP E R VNTVFQ+YALFPHMTV +NVAFGL+MQ   A E   RV++ALRMV 
Sbjct: 67  NGQVVNRVPPEQRQVNTVFQNYALFPHMTVRDNVAFGLKMQGVAADETARRVLDALRMVH 126

Query: 137 LETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRK 196
           LE FA RKP QLSGGQQQRVAIARAV+N P +LLLDE  SALD+KLRKQMQ E+K LQR+
Sbjct: 127 LENFADRKPRQLSGGQQQRVAIARAVINNPLVLLLDEPFSALDFKLRKQMQLEIKHLQRQ 186

Query: 197 LGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFNA 256
           LGITFVFVTHDQEEA  MSDR+VVM +GRIEQ G P+EIYEEP N++VA F+G+IN    
Sbjct: 187 LGITFVFVTHDQEEAFAMSDRVVVMNEGRIEQIGAPKEIYEEPANMYVARFVGDINALPG 246

Query: 257 TV-IERLD-----------------------------EQRVRANVEGRECNIYVNFAVEP 286
            +   RLD                             E    A V G    +     + P
Sbjct: 247 RIDAVRLDWSAAPGTPLAPPAPGTPEHAALPPDLKPGEHLYDATVGGTVFPVRSRRRLAP 306

Query: 287 GQKLHVLLRPEDLRVEEI--NDDNHAEGLIGYVRERNYKGMTLESVVELENGKMVMVSEF 344
           G  + VLLRPEDLR++ I   +      L G + E  YKG T++ V+ L++G+ +M +EF
Sbjct: 307 GDGVQVLLRPEDLRIDRIAVAETPDWPHLWGRIEESVYKGATVDLVITLDDGQRLMAAEF 366

Query: 345 FNEDDPDFDHSLDQKMAINWVESWEVVLADE 375
           FNEDD D +++  +++A++WV+ WEV+L D+
Sbjct: 367 FNEDDEDINYNPGERVAVSWVDGWEVLLPDD 397


Lambda     K      H
   0.319    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 464
Number of extensions: 21
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 378
Length of database: 399
Length adjustment: 30
Effective length of query: 348
Effective length of database: 369
Effective search space:   128412
Effective search space used:   128412
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory