Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate 8500850 DvMF_1588 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= CharProtDB::CH_088337 (275 letters) >FitnessBrowser__Miya:8500850 Length = 563 Score = 90.5 bits (223), Expect = 7e-23 Identities = 69/214 (32%), Positives = 106/214 (49%), Gaps = 11/214 (5%) Query: 9 LVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDPLYFEVLLHSLNMALIATLA 68 LV+ V +P L+I +F +F +V L P +E LL+SL +A T+ Sbjct: 24 LVIVVAVPVLLIFFNAFWVDGSPNFTDVVKILRQ------PDTYEALLNSLFIASGVTVM 77 Query: 69 CLVLGYPFAWFLAK--LPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTK-GYLNEFLL 125 +G FAW + + LP K +LFL VPF S I K+ LS + GY+N + Sbjct: 78 STTIGTFFAWLVTRTDLPFKAAMKVLFL--VPFMLPSFIGALAWKMLLSPRAGYINRLFM 135 Query: 126 WLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTF 185 P+ ++T ++ L PF+ + + ++E++D L EAAR GAS Sbjct: 136 DTFGFSGPVFDIYTYHGIMAVETMYLFPFVFIQVCGALERMDPTLEEAARISGASLFTIT 195 Query: 186 IRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMG 219 +I IPL MP I++G LL+ML +M F ++G Sbjct: 196 RKITIPLVMPSIVSGALLIMLYSMAHFGTVAVLG 229 Score = 68.6 bits (166), Expect = 3e-16 Identities = 57/232 (24%), Positives = 101/232 (43%), Gaps = 16/232 (6%) Query: 1 MIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDP--LYFEVLLHS 58 ++V + ++ + LP I L TLDNY +L L + + +S Sbjct: 307 LLVLCIAYIAFTIVLPTATIFLVGGLKTYGLPLTMENLTLDNYKFILFDWQLTRDAIWNS 366 Query: 59 LNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKG 118 +++ L A L + G ++ + K+ + + L FL ++PF + G+ Sbjct: 367 VSLGLAAALITMFAGVMISYVIVKMKVRGKGFLEFLGMLPFSVPGSVIALGV-------- 418 Query: 119 YLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLG 178 L W G I I T +++ + + F + +++E++ L+EAAR G Sbjct: 419 ----ILAWSGKFG--INIYNTVWIILVAYIARYMAFSLKANSAALEQVHDSLVEAARACG 472 Query: 179 ASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVI 230 A+ Q I++PL PG++A L+ LPA+ VS L+ G IG I Sbjct: 473 ATMWQALRDIVLPLVRPGMLAAFFLIFLPALRELTVSVLLYGPTTRTIGVAI 524 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 275 Length of database: 563 Length adjustment: 31 Effective length of query: 244 Effective length of database: 532 Effective search space: 129808 Effective search space used: 129808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory