Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate 8501225 DvMF_1959 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= CharProtDB::CH_088337 (275 letters) >FitnessBrowser__Miya:8501225 Length = 322 Score = 290 bits (743), Expect = 2e-83 Identities = 137/259 (52%), Positives = 189/259 (72%) Query: 8 WLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDPLYFEVLLHSLNMALIATL 67 WL LF LPNL ++ +FL R ++ FV +VFT DNY RL DP++ +L SL +A +TL Sbjct: 18 WLGLFALLPNLGLLLVTFLERGESDFVSLVFTWDNYARLADPVFIRILGESLWLAAASTL 77 Query: 68 ACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLLWL 127 CL++GYPFA+ +A +RP LL L+++PFWTNSLIR Y L I L ++G + L+ L Sbjct: 78 VCLLIGYPFAYAVATARRGLRPWLLLLVVIPFWTNSLIRTYALIIILKSQGIASNVLMAL 137 Query: 128 GVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTFIR 187 G++ P+ M+ AV GL Y LLPFM++PLY+SIEKLDK LL+AA+DLGAS L+ F Sbjct: 138 GLVSEPVSFMYGEFAVFTGLTYTLLPFMILPLYASIEKLDKRLLDAAKDLGASSLRAFWH 197 Query: 188 IIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFGAATS 247 + +PLT+PGI+AGC+LV LP++G FY+ +++GGAK++LIGN IK QFL RDWP GAA S Sbjct: 198 VTLPLTLPGIVAGCMLVFLPSLGCFYIPEILGGAKSMLIGNFIKNQFLVARDWPLGAAAS 257 Query: 248 ITLTIVMGLMLLVYWRASR 266 LT+++ LM++ YW +SR Sbjct: 258 TILTVLLVLMIIGYWLSSR 276 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 322 Length adjustment: 26 Effective length of query: 249 Effective length of database: 296 Effective search space: 73704 Effective search space used: 73704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory