Align spermidine/putrescine ABC transporter, permease protein PotB (characterized)
to candidate 8502260 DvMF_2970 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= CharProtDB::CH_088337 (275 letters) >FitnessBrowser__Miya:8502260 Length = 301 Score = 157 bits (397), Expect = 3e-43 Identities = 89/273 (32%), Positives = 152/273 (55%), Gaps = 7/273 (2%) Query: 2 IVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLL-DPLYFEVLLHSLN 60 + +V WL L + LP+L ++ SF R D +F ++L+NY + +P+Y+ + + Sbjct: 29 LTPVVLWLGLLIVLPHLDLLIMSF--RMDPAFGDDGWSLENYHQFFAEPIYWLTFVRTAG 86 Query: 61 MALIATLACLVLGYPFAWFLAKL-PHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGY 119 +++ TL ++ P A+++ K+ LL +L++PFW + L+R+YG I L G Sbjct: 87 YSVLVTLLTFLVSLPVAFYVTKVVARNTSRFLLTMLLLPFWVSELVRVYGWMILLRESGV 146 Query: 120 LNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGA 179 LN +L LG+ P+ +++ + +I+GLVY + FMV+PL S +E LD L+EAA DLGA Sbjct: 147 LNHWLTALGITGAPVEMLYNDATMIMGLVYTSMLFMVVPLVSVLESLDDSLIEAACDLGA 206 Query: 180 SKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRD 239 I++P MPGI++G ++V + +G + +LMGG +L I QF+ + Sbjct: 207 GPWTIMRTIVVPHCMPGIMSGAIVVFMLTLGNYLTPNLMGGKNSLWFTEQIYNQFIASFN 266 Query: 240 WPFGAATSITLTIVMGLMLLVYWRASRLLNKKV 272 W GAA +++ L + W RL +K+ Sbjct: 267 WNQGAAFGF---LLLALSSCIIWLGLRLTGQKL 296 Lambda K H 0.333 0.148 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 301 Length adjustment: 26 Effective length of query: 249 Effective length of database: 275 Effective search space: 68475 Effective search space used: 68475 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory