Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate 8500851 DvMF_1589 ABC transporter related (RefSeq)
Query= reanno::acidovorax_3H11:Ac3H11_2941 (350 letters) >FitnessBrowser__Miya:8500851 Length = 354 Score = 226 bits (575), Expect = 9e-64 Identities = 135/359 (37%), Positives = 199/359 (55%), Gaps = 24/359 (6%) Query: 1 MAYLQLRGIEKFFGEHRAIKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAIDGGSL 60 M+Y++L + K FG A+ ++L I +GE +GPSGCGK+T LR++AG E +D G + Sbjct: 1 MSYVRLVNVTKRFGGVTAVDSLNLEIGRGECFSMLGPSGCGKTTTLRMVAGFEDLDDGEI 60 Query: 61 MLDGRDITDQ------PSSKRDLAMVFQSYALYPHMSVYENMSFALKLAKVDKQVIDEKV 114 + R ++ + P KRD MVFQ++A++PH+SVYEN++F L++ ++ ID + Sbjct: 61 HVGDRLLSARRNNYYLPPEKRDFGMVFQAFAVWPHLSVYENVAFPLRIRRLSAAEIDRRT 120 Query: 115 QNAARILNLTQYLQRTPKELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRV 174 + A +L Q++P +LSGG +QRVA+ RA+ P V L DEPLS+LD LR + R Sbjct: 121 REALHHTSLADVAQKSPDDLSGGGKQRVALARALAINPDVMLLDEPLSSLDPHLREEMRF 180 Query: 175 EIAKLHRDLGATTIYVTHDQVEAMTLADRVVVLRDGIIEQVGTPLELYDKPANQFVAQFI 234 EI L R G + +YVTHDQ EAM L+DR++V+R+G+++QVGTPL++Y PAN FV FI Sbjct: 181 EIKDLQRTFGFSILYVTHDQSEAMALSDRIMVMRNGVVQQVGTPLDVYTNPANSFVFGFI 240 Query: 235 GTPQMNVVPVDKLPQPV-------QQQAPAAPAGAAV-----GAIGLRPENITVRTTGAT 282 G N + V+ P+ + + PA P A + A+ RP I G Sbjct: 241 GL--SNFLDVNLTPEGLVRVNGGDARVTPATPPSARLVSAGRAALASRPSEIDFTAEGG- 297 Query: 283 PVGGQVDLIEALGAETLIYVTTPGGAQFVSRQNDRTDLRVGDAVSLDIDASQAHWFDTA 341 + G V LG + G V + GDA L + HW+D A Sbjct: 298 -LRGVVRRRAYLGEIVDYRIDVSGQEVRVQKGRRAPGPAEGDACGLVF--LRPHWYDPA 353 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 354 Length adjustment: 29 Effective length of query: 321 Effective length of database: 325 Effective search space: 104325 Effective search space used: 104325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory