Align UTP--glucose-1-phosphate uridylyltransferase; Alpha-D-glucosyl-1-phosphate uridylyltransferase; General stress protein 33; GSP33; UDP-glucose pyrophosphorylase; UDPGP; Uridine diphosphoglucose pyrophosphorylase; EC 2.7.7.9 (characterized)
to candidate 8499282 DvMF_0060 UTP-glucose-1-phosphate uridylyltransferase (RefSeq)
Query= SwissProt::Q05852 (292 letters) >FitnessBrowser__Miya:8499282 Length = 291 Score = 284 bits (726), Expect = 2e-81 Identities = 140/284 (49%), Positives = 198/284 (69%) Query: 4 VRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKSKRA 63 +RK +IP AG GTR LPATK +PKEMLP+ +KP +QY++EEA+ +GI D++ VT + K+ Sbjct: 3 IRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAMRSGIGDVVFVTNRDKKI 62 Query: 64 IEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNFIGD 123 IEDHFDY+ +LE LE GKTE+L +V++ + + +I IRQK+ GLGHAV CAR+ + D Sbjct: 63 IEDHFDYNLQLEGVLERAGKTEMLRQVREVAEMVNIISIRQKQQLGLGHAVLCARDVVRD 122 Query: 124 EPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEGRRY 183 E FAV++GDD++ TPG++QL+D +IGV +VP ++ +RYGII + Sbjct: 123 ESFAVMVGDDLMFGMTPGIKQLIDVAASERLPVIGVMEVPADKVNRYGIISGEEFAPGIF 182 Query: 184 QVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEIQRV 243 +V VEKP G APS LAI+GRYV TP+IF LE+ + G GGEIQLTDA+Q L + + + Sbjct: 183 KVNKLVEKPKLGEAPSRLAIVGRYVLTPDIFRCLEQMKPGHGGEIQLTDALQMLADDRGL 242 Query: 244 FAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLL 287 A G R+D G+ ++T + FA+QD+ELRD+LV ++ LL Sbjct: 243 LAVKIRGMRFDAGDWAEYLTANIYFALQDEELRDELVRQLKPLL 286 Lambda K H 0.317 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 291 Length adjustment: 26 Effective length of query: 266 Effective length of database: 265 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 8499282 DvMF_0060 (UTP-glucose-1-phosphate uridylyltransferase (RefSeq))
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01099.hmm # target sequence database: /tmp/gapView.8261.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01099 [M=261] Accession: TIGR01099 Description: galU: UTP--glucose-1-phosphate uridylyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-108 346.5 0.1 5.9e-108 346.4 0.1 1.0 1 lcl|FitnessBrowser__Miya:8499282 DvMF_0060 UTP-glucose-1-phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499282 DvMF_0060 UTP-glucose-1-phosphate uridylyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 346.4 0.1 5.9e-108 5.9e-108 1 261 [] 3 263 .. 3 263 .. 1.00 Alignments for each domain: == domain 1 score: 346.4 bits; conditional E-value: 5.9e-108 TIGR01099 1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleaklek 77 irk+viP+aG+Gtr LPatk iPkemlp+ +kP++qyvveea+++Gi ++v+vt+r+k+ iedhfD++++le le+ lcl|FitnessBrowser__Miya:8499282 3 IRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAMRSGIGDVVFVTNRDKKIIEDHFDYNLQLEGVLER 79 89*************************************************************************** PP TIGR01099 78 knkeellkevrkiaelatilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeeealkqlielyektgasii 154 ++k+e+l++vr++ae+++i+ +rqk++ GLGhavl+a+++v de+fav++gDdl+ ++ +kqli++ + +i lcl|FitnessBrowser__Miya:8499282 80 AGKTEMLRQVREVAEMVNIISIRQKQQLGLGHAVLCARDVVRDESFAVMVGDDLMFGMTPGIKQLIDVAASERLPVI 156 ***************************************************************************** PP TIGR01099 155 aveevpkeevskYGvidgeeveeelyevkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkggeiqltDal 231 +v+evp+++v++YG+i+gee +++v++lvekPk eaps laivGrYvltp+if+ le++k+G+ggeiqltDal lcl|FitnessBrowser__Miya:8499282 157 GVMEVPADKVNRYGIISGEEFAPGIFKVNKLVEKPKLGEAPSRLAIVGRYVLTPDIFRCLEQMKPGHGGEIQLTDAL 233 ***************************************************************************** PP TIGR01099 232 rlllekeevlavklkgkryDvGdklgylka 261 ++l+++ +lavk++g r+D Gd +yl+a lcl|FitnessBrowser__Miya:8499282 234 QMLADDRGLLAVKIRGMRFDAGDWAEYLTA 263 ***************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.83 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory