Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate 8501893 DvMF_2608 inner-membrane translocator (RefSeq)
Query= TCDB::P21627 (307 letters) >FitnessBrowser__Miya:8501893 Length = 302 Score = 292 bits (748), Expect = 6e-84 Identities = 156/303 (51%), Positives = 216/303 (71%), Gaps = 6/303 (1%) Query: 6 HYLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGL 65 ++ + GLT GS YALIA+GYTMVYGII +INFAHGEVYM+G++ A I L + G Sbjct: 5 YFWELFFGGLTRGSIYALIALGYTMVYGIIELINFAHGEVYMMGAFTALIVAGALGIYGF 64 Query: 66 DSVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQ 125 ++ ++++AA A +I +A+G ++E++AY+PLR RL PLISAIGMSIFLQN V+L+Q Sbjct: 65 PALAILIIAAVVA-VIYCAAYGLTLEKIAYKPLRDAPRLSPLISAIGMSIFLQNYVILAQ 123 Query: 126 DSKEKAIPTLLPG-NFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACR 184 S P L+P +F+ + + G ++LI V + + M LTLFI +R+G+A R Sbjct: 124 TSDFMPFPNLVPQPDFLEPIAHIMGA----SEVLIIVTSAISMAALTLFIKYTRMGKAMR 179 Query: 185 ACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTA 244 A A++ KM LLGI+++ +I+LTFVIG++LAAV VL+ G +N IGF+AGIKAFTA Sbjct: 180 ATAQNRKMAMLLGIDADKVISLTFVIGSSLAAVGGVLIASHVGQVNFAIGFIAGIKAFTA 239 Query: 245 AVLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGRPEV 304 AVLGGIGSIPGAMLGGL+LG E+F Y+D +AF LL+L+L+FRP+GILG+ + Sbjct: 240 AVLGGIGSIPGAMLGGLVLGWCESFATGYISSDYEDALAFALLVLILIFRPSGILGKAKT 299 Query: 305 EKV 307 +KV Sbjct: 300 QKV 302 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 302 Length adjustment: 27 Effective length of query: 280 Effective length of database: 275 Effective search space: 77000 Effective search space used: 77000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory