GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gcvP in Desulfovibrio vulgaris Miyazaki F

Align Probable glycine dehydrogenase (decarboxylating) subunit 2; EC 1.4.4.2; Glycine cleavage system P-protein subunit 2; Glycine decarboxylase subunit 2; Glycine dehydrogenase (aminomethyl-transferring) subunit 2 (uncharacterized)
to candidate 8499451 DvMF_0223 glycine dehydrogenase subunit 2 (RefSeq)

Query= curated2:A7HLP1
         (477 letters)



>lcl|FitnessBrowser__Miya:8499451 DvMF_0223 glycine dehydrogenase
           subunit 2 (RefSeq)
          Length = 481

 Score =  506 bits (1303), Expect = e-148
 Identities = 256/476 (53%), Positives = 340/476 (71%), Gaps = 13/476 (2%)

Query: 2   TIFEKSTSGRKGYELPEYELPSVDCGIPEHLVRKEKPLLPEVSEVDVVRHYTELASKNYS 61
           T F  S  GR      + ++ + D  +P +L+R  +P LPE+ E+DVVRH+T L+  N+ 
Sbjct: 3   TAFAASVPGRNACLPAQPKMHAADM-LPANLLRASRPALPELGELDVVRHFTRLSRLNFG 61

Query: 62  VDKGFYPLGSCTMKYNPKINEDMAML--FTQLHPMQPR-----ETIQGAIDLMGHLKEML 114
           VD  FYPLGSCTMKYNPK  E +A L  FT+LHP+  +     +  QGA+++M   + +L
Sbjct: 62  VDSNFYPLGSCTMKYNPKFTEQVAALPGFTRLHPLMAQLKGAGQYTQGALEVMWETERLL 121

Query: 115 CEITGTDDMTLQPAAGAHGELTGLLVARAYFEDKGELDKRRKVLVPDSAHGTNPASAAMA 174
           CEITG    TL P AGAHGELTG+++  AY +DKG  +++ KV+ PDSAHGTNPASAA+A
Sbjct: 122 CEITGMRAFTLHPMAGAHGELTGVMLIAAYHKDKG--NRKTKVICPDSAHGTNPASAALA 179

Query: 175 GFEVVELKSGKDGCVNLEELKAHLDENVAVIMLTNPNTLGLFEKDILTIAKMAHEVGALL 234
           G+EVV ++S KDG V+ + L+A LD++VA +M+T PNTLGLFE  +  I +    V ALL
Sbjct: 180 GYEVVNIES-KDGMVDPDALEAALDDDVAALMMTCPNTLGLFENHLPRIVEKLRAVDALL 238

Query: 235 YYDGANLNAIMGRTRPGDMGFDIVHLNLHKTFSTPHGMGGPGSGPIGVKKHLAPYLPVPV 294
           YYDGANLNAI+G+ R GD+GFD+VHLNLHKTF+TPHG GGPG+GP+GV + L PYLP+  
Sbjct: 239 YYDGANLNAILGKMRVGDVGFDVVHLNLHKTFATPHGGGGPGAGPVGVSERLVPYLPISR 298

Query: 295 IRKAGE-KYDLDYNLPKSIGMVRSFYGNFTVMVKAYTYILTMGNKGLKHVSDMAVLNANY 353
           + K  + +Y L+Y+ PKSIG +  FYGNF V++KAY YIL +G +GL+ VS+ AVLNANY
Sbjct: 299 VEKLHDGRYYLNYDHPKSIGFMAPFYGNFGVLLKAYAYILRLGGEGLERVSEYAVLNANY 358

Query: 354 LRAKLSKIYKVAYDRICMHEFVIDNEEFVKKTGVKTLDIAKRLLDYGLHAPTVYFPLIVH 413
           LR +L K+ ++ +DRICMHEFV        + G++ LD+AK LLD G HAPT+YFPLIV 
Sbjct: 359 LRKRLEKVLEIPHDRICMHEFVASACNHA-ECGIRALDVAKALLDKGYHAPTIYFPLIVK 417

Query: 414 EAMMIEPTETESKRTLDEFIDAMEKIYNEAIENPELVKKAPYKTPIRRLDDVNATK 469
           E MM EPTETES++TLDEF D +  I   A +NP+ +  AP  TP+RRLD+  A +
Sbjct: 418 ECMMFEPTETESRQTLDEFADDLIAILESAAQNPDALHAAPVTTPVRRLDETAAAR 473


Lambda     K      H
   0.318    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 672
Number of extensions: 26
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 477
Length of database: 481
Length adjustment: 34
Effective length of query: 443
Effective length of database: 447
Effective search space:   198021
Effective search space used:   198021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory