Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate 8499281 DvMF_0059 phosphoglucosamine mutase (RefSeq)
Query= BRENDA::Q6I7B6 (450 letters) >FitnessBrowser__Miya:8499281 Length = 450 Score = 171 bits (432), Expect = 6e-47 Identities = 140/465 (30%), Positives = 235/465 (50%), Gaps = 45/465 (9%) Query: 2 RLFGTAGIRGTL-WEKVTPELAMKVGMAVGTY-----KSGKALVGRDGRTSSVMLKNAMI 55 RLFGT G+RG + +T ++A+++G+A GT+ + + ++G+D R S + ++A+ Sbjct: 4 RLFGTDGLRGQVNIYPMTADVALRLGLAAGTHFRNGNRRHRVVIGKDTRLSGYVFESALT 63 Query: 56 SGLLSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGTEFYV 114 +GL + GM+V +PTPA+A+ TR + AD GV+I+ASHNP DNG+K F+ DG + Sbjct: 64 AGLCAAGMDVYLVGPLPTPAIAFLTRNMRADLGVVISASHNPFMDNGIKFFDKDGFKLPD 123 Query: 115 EQERGLEEIIFSGNFRKARWDEIKPVR-----NVEVIPDYINAVL--DFVGHET--NLKV 165 E E + +++ ++ +WD P R +E P L F H T ++V Sbjct: 124 EMENKITDMVLDPDW---QWDYPAPERVGRAAKIEDSPGRYIVYLKNSFPAHLTLDGMRV 180 Query: 166 LYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVD 225 + D ANGA VAP L E+GA+V+ + +G + Y +A GK V E D Sbjct: 181 VLDCANGANYKVAPLALEELGAEVIKIGTEPNGLNINHQCGSLYPGVA-AGK-VLETRAD 238 Query: 226 LAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHG--GGTVVVSIDTGSRIDAVV 283 + +A DGDADR+ V DEKG +D D ++AL A + T+V ++ + ++ + Sbjct: 239 VGLALDGDADRLIVVDEKGTVLDGDQIMALCADDMLRRGALRNNTLVATVMSNMALEVYM 298 Query: 284 ERAGGRVVRIPLGQPH--DGIKRYKAIFAAE-PWKLVHPKFGPWIDPFVTMGLLIKLIDE 340 + G +++R P+G + + ++R A E L+ G D + +++++ E Sbjct: 299 KERGCKLLRTPVGDRYVVEAMRREGANLGGEQSGHLIFMDHGTTGDGLMAALQILRIMRE 358 Query: 341 -NGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSE-IKEVLT-ISGFR 397 + PLSEL ++ + + NV VERK+ E + VL ++ Sbjct: 359 RDRPLSELAGQLQLFPQELINV----------------HVERKIPFEQCQPVLDGVAKVE 402 Query: 398 IALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSR 442 L D +L+R SGTE RV+ E ++ L + TV + Sbjct: 403 AELGDRGRVLLRYSGTEAVCRVMVEGEDPEQVKRLASLLAETVQK 447 Lambda K H 0.318 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 450 Length adjustment: 33 Effective length of query: 417 Effective length of database: 417 Effective search space: 173889 Effective search space used: 173889 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory