Align TreV, component of Trehalose porter (characterized)
to candidate 8500849 DvMF_1587 ABC transporter related (RefSeq)
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__Miya:8500849 Length = 366 Score = 204 bits (518), Expect = 4e-57 Identities = 108/247 (43%), Positives = 163/247 (65%), Gaps = 9/247 (3%) Query: 3 VELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIAD 62 + L I K YG + V++G++ + GE F +LGPSG GK+ LL+++AG E D G I Sbjct: 4 ITLAGIGKAYGAHAVLDGLSLTVNHGECFTLLGPSGCGKTVLLRLIAGFETPDAGTISIG 63 Query: 63 GADITDK------PPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKA 116 G ++D PP+ R++ +VFQ+YA++P+MSV DNI +PLK+ G+ E +V + Sbjct: 64 GEPVSDAVTGDCVPPDARDLGVVFQDYAVWPHMSVADNIGYPLKLAGLPAAERTRQVLET 123 Query: 117 AKLLGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELK 176 +++ ++ + ++ +Q+SGGQQQRVALARA+V PS LLDEPL NLDA +R R E+K Sbjct: 124 VEMVNLTGLENRMPSQLSGGQQQRVALARALVGRPSLMLLDEPLCNLDANLREEMRFEIK 183 Query: 177 RIQKELKGTFIYVTHDQKEALSLADRIAIL-HKGKFEQVSDPKTLYEYPKTKWVAQFVGE 235 +Q+ L T +YVTHDQ+ AL+++DR+AI+ H G QV P ++E P ++V +F+G Sbjct: 184 ELQRTLGITILYVTHDQEIALAISDRLAIMDHAGAIRQVGTPWEIFERPADEFVFRFMG- 242 Query: 236 FPMNFLP 242 NFLP Sbjct: 243 -VANFLP 248 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 366 Length adjustment: 29 Effective length of query: 295 Effective length of database: 337 Effective search space: 99415 Effective search space used: 99415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory