Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate 8500845 DvMF_1583 ABC transporter related (RefSeq)
Query= TCDB::Q8DQH8 (254 letters) >FitnessBrowser__Miya:8500845 Length = 240 Score = 209 bits (531), Expect = 5e-59 Identities = 111/253 (43%), Positives = 165/253 (65%), Gaps = 16/253 (6%) Query: 1 MALLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTV 60 M++LE+++L+ FGGL A+ DV ++ +GE++ LIGPNGAGKTTLFN + G Y PSEG V Sbjct: 1 MSMLEIRKLSMFFGGLAALHDVNFDVRQGEILALIGPNGAGKTTLFNCVNGFYTPSEGQV 60 Query: 61 TLDGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPA 120 G ++G P+K+ +G+ RTFQ ++ ++V DNVL ++FLR P Sbjct: 61 LFKGQPISGLKPHKVCQMGIARTFQVVKPLSRMSVFDNVLA-----------SAFLRNP- 108 Query: 121 FYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAA 180 + K + A E+L L D + L+K L G+++RLEI RALAT+P+ L LDE A Sbjct: 109 ---TRKGAQDVADEVLHFTGLWDDRDQLSKGLPLGKRKRLEIARALATQPEFLLLDESFA 165 Query: 181 GMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIK 240 G+NP E ++IR IK + IT+M+IEH M ++M +++RI VL +G+ IA+GTP +I Sbjct: 166 GLNPAELDVSIDIIRGIKQQ-GITVMIIEHHMKVIMAISDRIVVLNFGQKIAEGTPAQIS 224 Query: 241 TNKRVIEAYLGGE 253 +++V+EAYLG E Sbjct: 225 ADRQVVEAYLGEE 237 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 240 Length adjustment: 24 Effective length of query: 230 Effective length of database: 216 Effective search space: 49680 Effective search space used: 49680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory