Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate 8500849 DvMF_1587 ABC transporter related (RefSeq)
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Miya:8500849 Length = 366 Score = 208 bits (529), Expect = 2e-58 Identities = 141/369 (38%), Positives = 196/369 (53%), Gaps = 29/369 (7%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MADI + K Y G VL L L + GE LLGPSGCGK+ +LR+IAG E GT Sbjct: 1 MADITLAGIGKAY-GAHAVLDGLSLTVNHGECFTLLGPSGCGKTVLLRLIAGFETPDAGT 59 Query: 61 LRIGGTVVND------LPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRR 114 + IGG V+D +P R++ +VFQ+YA++PHMSV DNI + L+ PAAE R+ Sbjct: 60 ISIGGEPVSDAVTGDCVPPDARDLGVVFQDYAVWPHMSVADNIGYPLKLAGLPAAERTRQ 119 Query: 115 VREVAALLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLR 174 V E ++NL L R P +SGGQQQR A+ARA++ PS+ L DEPL NLDA LR ++R Sbjct: 120 VLETVEMVNLTGLENRMPSQLSGGQQQRVALARALVGRPSLMLLDEPLCNLDANLREEMR 179 Query: 175 GDIKRLHQRLRTTTVYVTHDQLEAMTLADRVILMQD-GRIVQAGSPAELYRYPRNLFAAG 233 +IK L + L T +YVTHDQ A+ ++DR+ +M G I Q G+P E++ P + F Sbjct: 180 FEIKELQRTLGITILYVTHDQEIALAISDRLAIMDHAGAIRQVGTPWEIFERPADEFVFR 239 Query: 234 FIGTPAMNFLSGTVQRQDGQLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGE 293 F+G NFL R+ G + ++ G H MA RP VR+A + Sbjct: 240 FMG--VANFLPA---RRRGMAMLAAGGEQPVPWGLPDGDAEHWMA---GFRPSDVRLARQ 291 Query: 294 RE------PAASLTCPVSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLAL 347 + AS ++ L+E+ GA + L+ A+ P + Sbjct: 292 GDGLRGTVRRASFLGAMTDYLIEVDGASFRTQLDTHEALARGLMFAEGEP-------CVV 344 Query: 348 DQHELHVFD 356 H+LH FD Sbjct: 345 GFHDLHWFD 353 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 366 Length adjustment: 30 Effective length of query: 376 Effective length of database: 336 Effective search space: 126336 Effective search space used: 126336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory