Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate 8499437 DvMF_0209 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding (RefSeq)
Query= curated2:Q9YAW4 (335 letters) >FitnessBrowser__Miya:8499437 Length = 322 Score = 176 bits (447), Expect = 5e-49 Identities = 103/293 (35%), Positives = 155/293 (52%), Gaps = 4/293 (1%) Query: 36 PYETLLSKAREADALYTLLTDRIDCDLLSQAPRLRIVAQMAVGFDNIDVECATRLGIYVT 95 P E + +A A + T T +D D ++ P L + +A G+D +D+ A I V Sbjct: 34 PREAIRERAAGAHMVLTNKTP-LDADTIAALPDLAYIGVLATGYDVVDIRAAAARSIPVC 92 Query: 96 NTPGVLTEATAEFTWALILAAARRVVEADHFVRWGEWWRLRTGWHPMMMLGVELRGKTLG 155 N PG TEA A+ +A +L RR+ D V+ G W W +EL GK +G Sbjct: 93 NVPGYGTEAVAQHVFAFLLELCRRIARHDASVKVGNW-SANKDWCFWETTQIELTGKAMG 151 Query: 156 ILGMGRIGSRVAEIGKAFGMRIIYHSRSRKREIEKELGAEYRSLEDLLRESDILSIHLPL 215 I+G G +G RV +I AFGM+++ +S + + E A Y SL++L SD++++H PL Sbjct: 152 IVGFGNMGKRVGQIANAFGMKVLAYSPNTRTMPGYEPFA-YVSLDELFARSDVVTLHCPL 210 Query: 216 TDETRHLIGESELKLMKKTAILVNTGRGAIVDTGALVKALREGWIAAAALDVFEEEPLNP 275 TD TR ++ L MK+ AIL+NT RG ++D A+ AL + + +DV EP+ P Sbjct: 211 TDATRGMVNRVRLASMKQGAILINTARGPLLDEAAVAAALNDNHLGGLGVDVVAVEPIRP 270 Query: 276 NHPLTAFKNVVLAPHAASATRETRLRMAMMAAENLVAFAQGKVPPNLVNREVV 328 ++PL KN ++ PH A AT R + + A N+ AF G P N+V V Sbjct: 271 DNPLLTAKNCLITPHLAWATLTARQTLMRVTAGNIRAFLAG-APTNVVKAPTV 322 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 322 Length adjustment: 28 Effective length of query: 307 Effective length of database: 294 Effective search space: 90258 Effective search space used: 90258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory