GapMind for catabolism of small carbon sources

 

Protein Dsui_0636 in Dechlorosoma suillum PS

Annotation: Dsui_0636 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

Length: 245 amino acids

Source: PS in FitnessBrowser

Candidate for 23 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism aatQ hi Glutamate/aspartate import permease protein GltJ (characterized) 61% 100% 318.5 NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB 33% 129.0
L-aspartate catabolism aatQ hi Glutamate/aspartate import permease protein GltJ (characterized) 61% 100% 318.5 NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB 33% 129.0
L-glutamate catabolism gltJ hi Glutamate/aspartate import permease protein GltJ (characterized) 61% 100% 318.5 NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB 33% 129.0
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 33% 75% 129 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 33% 75% 129 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-asparagine catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 32% 80% 119.4 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-aspartate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 32% 80% 119.4 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-glutamate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 32% 80% 119.4 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-glutamate catabolism gltK lo Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) 31% 98% 117.9 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 30% 99% 114.8 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 30% 99% 114.8 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-arginine catabolism artQ lo ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) 31% 95% 111.7 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-citrulline catabolism AO353_03050 lo ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized) 31% 95% 111.7 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 32% 93% 110.9 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-asparagine catabolism natH lo Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale) 32% 54% 109 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-aspartate catabolism natH lo Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale) 32% 54% 109 Glutamate/aspartate import permease protein GltJ 61% 318.5
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-Glucosamine, permease component 1 (characterized) 32% 92% 108.2 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-asparagine catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 32% 58% 102.8 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-aspartate catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 32% 58% 102.8 Glutamate/aspartate import permease protein GltJ 61% 318.5
D-alanine catabolism Pf6N2E2_5403 lo ABC transporter for D-Alanine, permease component 2 (characterized) 31% 66% 101.3 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-arginine catabolism artM lo Histidine transport system permease protein HisM (characterized) 30% 90% 93.2 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-histidine catabolism hisM lo Histidine transport system permease protein HisM (characterized) 30% 90% 93.2 Glutamate/aspartate import permease protein GltJ 61% 318.5
L-lysine catabolism hisM lo Histidine transport system permease protein HisM (characterized) 30% 90% 93.2 Glutamate/aspartate import permease protein GltJ 61% 318.5

Sequence Analysis Tools

View Dsui_0636 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNYNWNWSVFLTPVPSGETTYLGWLFTGLQWTVALSLSAWVIALVVGSIVGVLRTVPNRW
LSGFAAVYVECFRNVPLLVQLFSWYFVLPELLPPALGNAYKQSDPLLQQFLAAMLCLGLF
TAARVAEQVRAGIESLPRGQRNAGLAMGFTLAQVYRHVLLPMAFRIIVPPLTSEFLNIFK
NSAVATTIGLIELSRQAQQLVDYTAQPYEAFIAVTLLYVCINVTVMFLMRRLEEKVRVPG
FIGGK

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory