GapMind for catabolism of small carbon sources

 

Protein Dsui_1833 in Dechlorosoma suillum PS

Annotation: FitnessBrowser__PS:Dsui_1833

Length: 266 amino acids

Source: PS in FitnessBrowser

Candidate for 11 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 44% 94% 208 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 40% 55% 160.6 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 37% 58% 154.1 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 38% 61% 153.3 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 64% 148.7 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 64% 148.7 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 56% 147.1 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 56% 147.1 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 37% 57% 144.4 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 34% 73% 142.9 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2
D-mannitol catabolism mtlK lo ABC transporter for D-mannitol and D-mannose, ATPase component (characterized) 36% 58% 142.9 Nitrate import ATP-binding protein NrtC; EC 7.3.2.4 56% 296.2

Sequence Analysis Tools

View Dsui_1833 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MEKFVQIEAVGQTFDTKKGKFVALRDVDLSIRQGEFIALIGHSGCGKSTLLNLIAGLTRP
TDGALICDGREIAGPGPERGVVFQNHSLLPWLTCFDNVYLAVERVFAAKEGKAKLKQRTH
DALALVGLTHAETKFPHEISGGMKQRVGIARALSMQPKVLLMDEPFGALDALTRAKLQDE
LMKICDATQATVVMVTHDVDEAVLLSDRIVMMTNGPAATIGEILSVDLPRPRNRLALAND
PKYIAARAAVLEFLYEKQAHKEVLAA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory