Align BadH (characterized)
to candidate Dsui_2538 Dsui_2538 acetoacetyl-CoA reductase
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__PS:Dsui_2538 Length = 246 Score = 157 bits (397), Expect = 2e-43 Identities = 91/249 (36%), Positives = 141/249 (56%), Gaps = 10/249 (4%) Query: 6 NKTAVITGGGGGIGGATCRRFAQEGAKI-AVFDLNLDAAEKVAGAIRDAGGTAEAVRC-- 62 +K A++TG GG+G A + A+EG K+ A + D E+ A ++A G + V Sbjct: 2 SKVALVTGALGGLGTAISQALAKEGYKVVAAYHPEFDKKEEWL-AEQEAAGFKDFVLVPG 60 Query: 63 DIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMH 122 D++D S A IA GP+DILVNNAG K F K + G+W+ +I NL ++ Sbjct: 61 DVSDYESAKAMIAEAEAKAGPIDILVNNAGITRDKFFVKMDKGQWDAVINTNLNSLFNVT 120 Query: 123 HAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNV 182 H V M ER GRIVNI+S G +G+ Y+A K G++ F+K LA+E A G+TVN Sbjct: 121 HHVAAKMGERGWGRIVNISSVNGVKGQAGQTNYSAAKAGVIGFTKALAQEFAAKGVTVNA 180 Query: 183 VCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITG 242 + PG T ++ + E +++ ++P+ RL KP+++ A+ + S+ AGF+TG Sbjct: 181 IAPGYVATKMVTAIR------EDILKGIIDSVPMKRLAKPEEIGAAVVYLTSELAGFVTG 234 Query: 243 QVLSVSGGL 251 L+++GGL Sbjct: 235 ATLNINGGL 243 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 246 Length adjustment: 24 Effective length of query: 231 Effective length of database: 222 Effective search space: 51282 Effective search space used: 51282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory