Align 3-oxoadipate CoA-transferase (EC 2.8.3.6) (characterized)
to candidate Dsui_2117 Dsui_2117 acyl CoA:acetate/3-ketoacid CoA transferase, beta subunit
Query= reanno::pseudo3_N2E3:AO353_17200 (259 letters) >FitnessBrowser__PS:Dsui_2117 Length = 288 Score = 172 bits (435), Expect = 9e-48 Identities = 101/258 (39%), Positives = 143/258 (55%), Gaps = 13/258 (5%) Query: 1 MAYSTNEMMTVAAARRLKNGSVCFVGIGLPSKAANLARLTSSPDVVLIYESGPIGAKPTV 60 + YS EMM +AA R +K+G + G+GL A A+ P++ + E G GA P Sbjct: 22 LRYSRQEMMAIAAGREIKDGELAIFGVGLSLLAGYFAQEHHGPNIRSMTEGGIYGATPIG 81 Query: 61 -LPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQVDRFGNINTTVV----- 114 LP I L+ A + + + + GR+DVG +GAAQVD+FGN+NTT + Sbjct: 82 GLPWGIECNRLSANATSFTGGLDALGFLVASGRVDVGLIGAAQVDKFGNVNTTGIWSKSG 141 Query: 115 ------GD-YHQPKVRLPGAGGAPEIAGSAKSVLIILKQSARSFVDKLDFITSVGHGEGG 167 GD Y PK RL GAGGA +IA AK +I++ A+ FVDK+D+I+S G+ EGG Sbjct: 142 DRSQGLGDTYTPPKTRLTGAGGANDIASGAKRTVIMVTHEAKRFVDKVDYISSPGYLEGG 201 Query: 168 DSRKRLGLPGAGPVGIITDLCIMEPEAGTNEFVVTALHPGVTREQVIAATGWAVRFADQL 227 D+R R G G GP I+T L I+ P T EF + A +P + ++V A TGW ++ Sbjct: 202 DARARYGFVGGGPSAIVTTLGILRPHPETKEFWLDAYYPFSSVDEVRAQTGWDLKVFRHA 261 Query: 228 EHTAEPTAIELAALRDLE 245 A PT E+ ALR ++ Sbjct: 262 RMIAPPTVAEVEALRRVD 279 Lambda K H 0.317 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 288 Length adjustment: 25 Effective length of query: 234 Effective length of database: 263 Effective search space: 61542 Effective search space used: 61542 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory