GapMind for catabolism of small carbon sources

 

Aligments for a candidate for hcl in Dechlorosoma suillum PS

Align 4-hydroxybenzoate--CoA/benzoate--CoA ligase; 4-hydroxybenzoyl-CoA synthetase; EC 6.2.1.25; EC 6.2.1.27 (characterized)
to candidate Dsui_2069 Dsui_2069 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II

Query= SwissProt::Q53005
         (539 letters)



>lcl|FitnessBrowser__PS:Dsui_2069 Dsui_2069 acyl-CoA synthetase
           (AMP-forming)/AMP-acid ligase II
          Length = 529

 Score =  165 bits (417), Expect = 5e-45
 Identities = 148/499 (29%), Positives = 218/499 (43%), Gaps = 27/499 (5%)

Query: 31  QRSLSYGELRDAVARVGPMLARLGVEQENRIALVLKDTVDFPILFWGAIRAGIVPVLLNT 90
           +R  +Y +L   V R    L  LGV++ + +A  L +T  F      A R G V   +N 
Sbjct: 38  RRVWTYAQLNAEVNRHAHALLALGVQKGDVVAAFLYNTPAFVFSLLAAARVGAVFNPINY 97

Query: 91  RLTADQYRYLLEDSRSRVVFASSEFLPVIEEAAAD-LPHLRTIIAVGDA-PA-PTLQLAN 147
           RL A +  ++LED +++V+    E   V+E+A    +P    I A  DA PA  T +L  
Sbjct: 98  RLAAQELAFILEDGQAKVLLFEKEGCEVVEKAREHGVPTAHWIYADSDAAPAFATARLDQ 157

Query: 148 LLATEQEGGAPAATCADDIAYWQYSSGTTGMPKGVMHVHSSPRVMAENAGRRIGYREDDV 207
           L+  +     P     +D     Y+SGTTG PKGV+H H S         + +    +DV
Sbjct: 158 LVRHQPATLPPVIVEENDNCILMYTSGTTGRPKGVLHTHRSKLAHNAMMHQAMTLSREDV 217

Query: 208 VFSAAKLFFAYGLGNAMFCPMGIGATSVLYPERPTADSVFDTLRLHQPTLLFAVPTLYAA 267
             + A L     L  +    + +GAT VL   R  A   +    + + T  FA PT+   
Sbjct: 218 GLAVAPLNHTAELHTSFLPRLQLGATQVLL-RRFDAGEAWRLTEVEKVTHFFAAPTMVTL 276

Query: 268 MLADPRSRTETLPDRLRLCVSAGEPLPAQVGLNWRNRFGHDIVNGVGSTEMGHLFLTNLP 327
           +L  P   +  L   LRL    G  +   +   W  + G  +V   G+TEMG       P
Sbjct: 277 LLHHPDVASRDLSS-LRLVEYGGASMAPHLIREWDKKVGAGLVQIYGTTEMGPCMSVLYP 335

Query: 328 HAV--EYGTSGVPVDGYRLRLV--------GDRGQDVADDEIGELLVSGGSSAAGYWNQR 377
           H      G++G+P   + L +          D     A DE+GE+LV G     GY N+ 
Sbjct: 336 HEQLSHAGSAGLPSLNHDLLVARVKADGSPSDPADLAAPDEVGEILVRGPCMMGGYLNRP 395

Query: 378 DKTRTTFVGEWTRTGDKYHRRADGVYTYCGRTDDIFKVSGIWVSPFEIEQALMSHAKVLE 437
           +         W  TGD      +G      R D +       V P E+E AL+ H  VLE
Sbjct: 396 EANARALAFGWYHTGDLGSLDKEGYLWIRDRIDHMINSGAENVYPREVEDALVEHPGVLE 455

Query: 438 AAVI-PAEDTDGLIKPKAFIVLASRGDIDPGA-LFDELKEHV---KSAIGPWKYPRWIQI 492
            AV+   +DT G        V+A+     PGA L  E  +H       +  +K PR    
Sbjct: 456 VAVVGEPDDTWGQ-------VVAAHVVAKPGATLTQEALDHFLLEGDRLAHYKRPRRYHF 508

Query: 493 MDDLPKTSSGKLQRYLLRE 511
           ++ LPKT+SGK+Q++LLR+
Sbjct: 509 IEALPKTTSGKIQKHLLRQ 527


Lambda     K      H
   0.320    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 715
Number of extensions: 36
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 539
Length of database: 529
Length adjustment: 35
Effective length of query: 504
Effective length of database: 494
Effective search space:   248976
Effective search space used:   248976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory