Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate Dsui_3239 Dsui_3239 acetyl-CoA acetyltransferase
Query= metacyc::MONOMER-15952 (401 letters) >FitnessBrowser__PS:Dsui_3239 Length = 392 Score = 290 bits (741), Expect = 7e-83 Identities = 172/399 (43%), Positives = 239/399 (59%), Gaps = 10/399 (2%) Query: 3 EALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQAGE 62 E +++ AVR+ +G + G+LA + +LG + +K IAR +D AV G Sbjct: 4 EIVVLSAVRSAVGGFGGSLAGMEPAELGGLVVKEAIAR-AGVDPKAVTFATVGNCIPTET 62 Query: 63 DNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMSR 122 VAR+A + G+ + +NRLCGS + A+ S+A+A+ G+A + GGVE MSR Sbjct: 63 RYAYVARLATIQGGMSMDSVAFAVNRLCGSAMQAIVSSAQAIMLGDADYAIGGGVEVMSR 122 Query: 123 APFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRADQD 182 +++ A A + DT V+ L FG+ M TAEN+ ++ ++R +QD Sbjct: 123 GAYLL----PALRSGARMGDTKAIDAMVSVLTDP-FGVGHMGITAENLVTKWGLTREEQD 177 Query: 183 AFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGTPF 242 AFAL SQ++AA AIA GR +IV + +KG + + DEHPR TT+E LAK+ F Sbjct: 178 AFALESQNRAAKAIAEGRFKSQIVPITFQTKKGDV-VFDTDEHPRA-TTMEALAKMKAAF 235 Query: 243 RQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGPVPA 302 ++ GSVTAGNASG+ND A L+LA + A G K AR+V A AGV IMG GP+P+ Sbjct: 236 KKDGSVTAGNASGINDAAAFLVLADAAKAAAAGHKPIARLVSYAIAGVPNEIMGEGPIPS 295 Query: 303 TRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPLGMS 362 ++ L+ GL L +D++E NEAFAAQ LAV + LGL D + N NGGAIALGHP+G + Sbjct: 296 SKLALQKAGLTLDQIDLVESNEAFAAQSLAVAKGLGL--DPAKTNVNGGAIALGHPVGAT 353 Query: 363 GARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401 G +VT LHE++ RY + TMCIG GQGI I ERI Sbjct: 354 GGVIVTKLLHEMQRTGARYGMATMCIGGGQGITTIYERI 392 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 392 Length adjustment: 31 Effective length of query: 370 Effective length of database: 361 Effective search space: 133570 Effective search space used: 133570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory