Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate Dsui_0317 Dsui_0317 acetyl-CoA acetyltransferase
Query= metacyc::MONOMER-20679 (395 letters) >FitnessBrowser__PS:Dsui_0317 Length = 399 Score = 285 bits (728), Expect = 2e-81 Identities = 163/394 (41%), Positives = 242/394 (61%), Gaps = 7/394 (1%) Query: 3 EAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAG-IDPKEVEDVVMGAAMQQG 61 +A IV+ R P+ K G T +L HA++ + + +DP VEDV++G AM + Sbjct: 7 DAYIVAATRLPVAKR-NGMFKTTRPDDMLAHALKSVMAQVPQLDPALVEDVIVGCAMPEA 65 Query: 62 ATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESIS 121 G N+AR LL AGLP T G TI+R C+SG+QA+A AA + ++ + G E++S Sbjct: 66 EQGMNVARIGLLLAGLPDTVPGLTINRFCSSGVQAVADAAARIRLGEADVMLAAGTETMS 125 Query: 122 LVQNDKMNTFHAVDPALEAIKGDVYMA--MLDTAETVAKRYGISRERQDEYSLESQRRTA 179 L+ + M +++PA+ +V +A M TAE VA+++GISR+ QD +++ S ++ Sbjct: 126 LM-SQMMGNKVSLNPAIFEKDENVAIAYGMGLTAEKVAQKWGISRDDQDAFAVASHQKAV 184 Query: 180 AAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGLKAVRGE 239 AA GKF DEI+P + + + D +G V + DEGPRP+++ +GLA LK V Sbjct: 185 AAIAAGKFKDEISPYTVRAHLPDLKSGTVRIVEKVCDTDEGPRPDSSLQGLAKLKPVFNA 244 Query: 240 GFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIGPVFAVP 299 ++TAGN+SQ+SDGA A +++S+K L+PL F G G P+ MGIGP+ A+P Sbjct: 245 RGSVTAGNSSQMSDGAGAVLLVSEKILKQFNLQPLARFAGFSVAGVPPEIMGIGPIAAIP 304 Query: 300 RLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYGMSGARL 359 ++L + G+ DD+ ELNEAFA Q L +LG+DP K+N GGAI++GHP G +GA + Sbjct: 305 KVLAQAGIKQDDLDWIELNEAFAAQALAVTRELGLDPAKINPQGGAIALGHPLGATGA-I 363 Query: 360 AGHALIEG-RRRKAKYAVVTMCVGGGMGSAGLFE 392 L+ G RR K+ +VTMC+G GMG+AGLFE Sbjct: 364 RTATLVHGMRRENKKWGMVTMCIGTGMGAAGLFE 397 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 399 Length adjustment: 31 Effective length of query: 364 Effective length of database: 368 Effective search space: 133952 Effective search space used: 133952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory