Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate Dsui_0976 Dsui_0976 acetyl-CoA acetyltransferase
Query= metacyc::MONOMER-20679 (395 letters) >FitnessBrowser__PS:Dsui_0976 Length = 393 Score = 219 bits (559), Expect = 8e-62 Identities = 145/391 (37%), Positives = 212/391 (54%), Gaps = 24/391 (6%) Query: 5 VIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQGATG 64 VIVS ARTP+G ++G N+ L AI+ AV+RAGI P++VE+VV G +Q G G Sbjct: 6 VIVSVARTPMG-GFQGDFNSLTAPQLGATAIKAAVERAGIKPEQVEEVVFGNVLQAGV-G 63 Query: 65 GNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESISLVQ 124 AR+A L AGLP++ TTI + C S L+++ + S+L EI V GG ES+S Sbjct: 64 QAPARQAALGAGLPLSAGCTTIHKVCGSALKSVMMVHDSLLAGSYEIGVAGGQESMSNAP 123 Query: 125 --------NDKMNTFHAVDPALEAIKGDVYMA---MLDTAETVAKRYGISRERQDEYSLE 173 ++ +D D Y M AE A+ YG +RE QDE++++ Sbjct: 124 YLLPKARGGYRLGHGQLLDHMFFDGLEDAYQKGRLMGTFAEECAESYGFTREAQDEWAIQ 183 Query: 174 SQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRPETTAEGLAGL 233 S R A + G F EIAP+ T A D+ + QDE P + E + L Sbjct: 184 STVRAQKAIKEGLFKWEIAPV----------TIAGKKGDVVVDQDEQPL-KAQIEKIPAL 232 Query: 234 KAVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGCEPDEMGIG 293 K + T+TA N+S +SDGA+A V+M + A GL P+ G ++ EP+ Sbjct: 233 KPAFKKDGTVTAANSSSISDGAAALVLMKESKAKVLGLAPIAKIVGHTTHAQEPNLFTTA 292 Query: 294 PVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAISVGHPYG 353 PVFA+ +L+++ G +V D+ LWE+NEAFAV + L +DP K+NV+GGA ++GHP G Sbjct: 293 PVFAMEKLMQKTGWNVADVDLWEINEAFAVVTMAAIKDLKLDPAKVNVHGGACALGHPIG 352 Query: 354 MSGARLAGHALIEGRRRKAKYAVVTMCVGGG 384 SGAR+ + ++ K V ++C+GGG Sbjct: 353 ASGARILVTLIGALKQYGKKKGVASLCIGGG 383 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 393 Length adjustment: 31 Effective length of query: 364 Effective length of database: 362 Effective search space: 131768 Effective search space used: 131768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory