Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate Dsui_1110 Dsui_1110 branched-chain amino acid ABC-type transport system, permease component
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__PS:Dsui_1110 Length = 297 Score = 128 bits (321), Expect = 2e-34 Identities = 92/309 (29%), Positives = 152/309 (49%), Gaps = 20/309 (6%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSL 60 M++F + LI GL G +Y +A+G+ M+Y G+ NFA G + F A +TF+ + Sbjct: 1 MQFFFEVLIGGLLSGVMYSFVALGFVMIYKASGVFNFAQGAM----VFFAALTFVGFQEM 56 Query: 61 GIT-WVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQ 119 G W LAL++ A +L G ERI RPL + P + ++ IG++ F++ Q Sbjct: 57 GAPFW--LALILAFGAMVLL----GIATERIVLRPLVNQPHITLFMATIGLTFFVEGLAQ 110 Query: 120 ILQGARSKPLQPIL---PGNLTLMDGAVSVSYVRLATIVITIALMYGFTQLITRTSLGRA 176 + G+ + L + P + + VS L + AL+ T +GRA Sbjct: 111 GIWGSTVRGLDLGIQDEPIEWIMDKAGILVSSFDLFAAGVAAALVTLLALFFQYTRVGRA 170 Query: 177 QRACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAF 236 RA D + A +G+ + + + + + +A VAG++ GV F + F A +KA Sbjct: 171 LRAVADDHQAALSIGIPLQNIWRIVWAVAGFVALVAGLLWGARNGV-QFALTFTA-LKAL 228 Query: 237 TAAVLGGIGSLPGAMLGGVVIG----LIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGL 292 +LGG S+PGA++GG++IG L E + GY+G + + + L+ RP GL Sbjct: 229 PVLILGGFTSVPGAIVGGLIIGSTEKLAEVYLGGYVGGGIDSWFPYVMALAFLLIRPEGL 288 Query: 293 LGRPEIEKV 301 G I++V Sbjct: 289 FGEKHIDRV 297 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 297 Length adjustment: 27 Effective length of query: 274 Effective length of database: 270 Effective search space: 73980 Effective search space used: 73980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory