Align ABC transporter for D-Alanine, permease component 2 (characterized)
to candidate Dsui_0636 Dsui_0636 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= reanno::pseudo6_N2E2:Pf6N2E2_5403 (375 letters) >FitnessBrowser__PS:Dsui_0636 Length = 245 Score = 94.4 bits (233), Expect = 3e-24 Identities = 76/252 (30%), Positives = 123/252 (48%), Gaps = 26/252 (10%) Query: 125 WYFAVFLSMPGPRAAHNFGDTFFVSSRGLNMPAALVAEGFWPFVISVVLAIVAIVLMT-- 182 W ++VFL+ P P + F GL AL + VI++V+ + VL T Sbjct: 5 WNWSVFLT-PVPSGETTYLGWLFT---GLQWTVALSLSAW---VIALVVGSIVGVLRTVP 57 Query: 183 -RWANKRFEATGEPFHKFWVGLALF---LVIPALSALLFGAPVHWEMPELKGFNFVGGWV 238 RW + E F + + LF V+P L +P G + Sbjct: 58 NRWLSGFAAVYVECFRNVPLLVQLFSWYFVLPEL------------LPPALGNAYKQSDP 105 Query: 239 LIPELLALTLALTVYTAAFIAEIVRSGIKSVSHGQTEAARSLGLRNGPTLRKVIIPQALR 298 L+ + LA L L ++TAA +AE VR+GI+S+ GQ A ++G R V++P A R Sbjct: 106 LLQQFLAAMLCLGLFTAARVAEQVRAGIESLPRGQRNAGLAMGFTLAQVYRHVLLPMAFR 165 Query: 299 VIIPPLTSQYLNLAKNSSLAAGIGYPEMVSLFAGTVLNQTGQAIEVIAITMSVYLAISIS 358 +I+PPLTS++LN+ KNS++A IG E+ S A +++ T Q E +Y+ I+++ Sbjct: 166 IIVPPLTSEFLNIFKNSAVATTIGLIEL-SRQAQQLVDYTAQPYEAFIAVTLLYVCINVT 224 Query: 359 ISLLMNWYNKRI 370 + LM +++ Sbjct: 225 VMFLMRRLEEKV 236 Score = 53.1 bits (126), Expect = 8e-12 Identities = 26/69 (37%), Positives = 40/69 (57%) Query: 61 SYARVFLIGLLNTLLVTFIGVILATILGFIIGVARLSQNWIISKLATVYVEVFRNIPPLL 120 +Y GL T+ ++ ++A ++G I+GV R N +S A VYVE FRN+P L+ Sbjct: 20 TYLGWLFTGLQWTVALSLSAWVIALVVGSIVGVLRTVPNRWLSGFAAVYVECFRNVPLLV 79 Query: 121 QILFWYFAV 129 Q+ WYF + Sbjct: 80 QLFSWYFVL 88 Lambda K H 0.328 0.141 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 375 Length of database: 245 Length adjustment: 27 Effective length of query: 348 Effective length of database: 218 Effective search space: 75864 Effective search space used: 75864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory