Align ABC transporter for D-Alanine, ATPase component (characterized)
to candidate Dsui_2068 Dsui_2068 ABC-type metal ion transport system, ATPase component
Query= reanno::pseudo6_N2E2:Pf6N2E2_5405 (254 letters) >FitnessBrowser__PS:Dsui_2068 Length = 278 Score = 146 bits (368), Expect = 5e-40 Identities = 89/222 (40%), Positives = 132/222 (59%), Gaps = 7/222 (3%) Query: 15 IQMQGVNKWY----GQFHVLKDINLNVKQGERIVLCGPSGSGKSTTIRCLNRLEEHQQGR 70 + ++GV+K + GQ + +L+V GE + G SG+GKST +R N LE G+ Sbjct: 11 LALRGVSKSFRTPDGQQVGVHPTDLDVAPGEIHGIIGFSGAGKSTLLRLANLLERPDAGQ 70 Query: 71 IVVDGVEL-TNDLKQIEAIRREVGMVFQHFNLFPHLTILQNCTLAPMWVRKMPKRKAEEI 129 +VV G +L T + R+ +GM+FQHFNL + T+ N P+ + + + E Sbjct: 71 VVVHGQDLMTLSPADLRTARQRIGMIFQHFNLLHNRTVADNVAF-PLRIAGADEARINER 129 Query: 130 AMHYLERVRIPEQAHKYPGQLSGGQQQRVAIARALCMKPKIMLFDEPTSALDPEMVKEVL 189 LE V + E+A YP QLSGGQ+QRVAIARAL +P ++L DEPTSALDP + +L Sbjct: 130 VKTCLEFVGLSEKAGVYPAQLSGGQKQRVAIARALAPEPHVLLADEPTSALDPRTTQSLL 189 Query: 190 DTMIGLAED-GMTMLCVTHEMGFARTVANRVIFMDKGEIVEQ 230 + + + G+T+L V+HEMG R + +RV M+ G+IVE+ Sbjct: 190 EVLADVNRRLGVTILLVSHEMGVIRRLCHRVSVMEAGQIVER 231 Lambda K H 0.322 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 278 Length adjustment: 25 Effective length of query: 229 Effective length of database: 253 Effective search space: 57937 Effective search space used: 57937 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory