Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate Dsui_0124 Dsui_0124 lactate dehydrogenase-like oxidoreductase
Query= BRENDA::Q9I530 (329 letters) >FitnessBrowser__PS:Dsui_0124 Length = 322 Score = 157 bits (397), Expect = 3e-43 Identities = 98/258 (37%), Positives = 138/258 (53%), Gaps = 17/258 (6%) Query: 70 RLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTRE 129 ++VA+ + G N+VDL AA G+ V ++ Y+ H V EH L+L L+R L E Sbjct: 65 KMVAVAATGTNNVDLEAARRQGIVVSNIQGYAVHTVPEHVFSLLLALSRNLLAYRQSVAE 124 Query: 130 GDFSLHGLTGF------DLHGKRVGVIGTGQIGETFARIMAGFGCELLAYDPYPNPRIQA 183 G + F DLHG +GV+G G +G+ R+ FG ++L + Sbjct: 125 GRWQRAEQFCFFDHPIRDLHGATLGVVGGGSLGQGVVRLAQAFGMKVLQAE---RKGAAV 181 Query: 184 LGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNAAAL 243 + Y A +LAE+D +SLHCPLTA+TRHLI A L MKP A+LINT RG LV+ AAL Sbjct: 182 VRPGYTAFATVLAEADALSLHCPLTAETRHLIGAAELQAMKPSALLINTARGGLVDEAAL 241 Query: 244 IEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLTREA 303 AL+ G + G DV E D PL + LL+ PN ++T H A+ + A Sbjct: 242 ARALREGWIAGAGFDVLTAE-----PPTDDHPL---LSPDLLAAPNFLLTPHVAWASAPA 293 Query: 304 LAAIADTTLDNIAAWQDG 321 + A+AD +DN+ A+ G Sbjct: 294 MQALADQLIDNLEAFARG 311 Lambda K H 0.323 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 322 Length adjustment: 28 Effective length of query: 301 Effective length of database: 294 Effective search space: 88494 Effective search space used: 88494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory