GapMind for catabolism of small carbon sources

 

Aligments for a candidate for glcD in Dechlorosoma suillum PS

Align D-lactate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate Dsui_2542 Dsui_2542 FAD/FMN-dependent dehydrogenase

Query= reanno::Smeli:SMc00832
         (479 letters)



>lcl|FitnessBrowser__PS:Dsui_2542 Dsui_2542 FAD/FMN-dependent
           dehydrogenase
          Length = 468

 Score =  185 bits (470), Expect = 3e-51
 Identities = 146/477 (30%), Positives = 237/477 (49%), Gaps = 38/477 (7%)

Query: 20  EIVADLADLLPEGGLISDERGLKPFETDAFIAYRRMPLAVVLPETTEHVAAVLKYCSRYG 79
           ++   LA ++    +++ E  L P+ TD    YR   LA+V P +T+ VAAV++ C+  G
Sbjct: 3   DLQQQLAAIVGPVHVLTGEAELAPYLTDWRGRYRGRALALVKPGSTDEVAAVVRACAAAG 62

Query: 80  IPIVPRGAGTSLSGGAIPQED--AIVVGLSKMSRTLDIDLFNRTATVQAGVTNLNISDAV 137
           +P+VP+G  TSL G A P +   +++V LS+++R   ID  N   TV+AG     + +A 
Sbjct: 63  VPMVPQGGNTSLCGAATPDQGGCSVLVNLSRLNRIRQIDAANNAITVEAGCLLAQVQEAA 122

Query: 138 SADGFFYAPDPSSQLACTIGGNIGMNSGGAHCLKYGVTTNNLLGVKMVLFDGTVIE-LGG 196
           +A G  +    +S+ +C IGGN+  N+GG   L+YG T    LG+++VL DG +   L  
Sbjct: 123 AAAGRLFPLALASEGSCQIGGNLSTNAGGVQVLRYGNTRELTLGLEVVLPDGRLWNGLTA 182

Query: 197 KALDAPGYDLLGLVCGSEGQLGIVTEATVRLIAKPEGARPVLFGFASSESAGSCVADIIG 256
              D  GYDL  L  G+EG LGI+T A ++L  +P   R V+  + +     + +A ++G
Sbjct: 183 LRKDNTGYDLKDLFIGAEGTLGIITAAVLKLFPRP---RAVVTAWLAVADGAAAIA-LLG 238

Query: 257 SGIIP-----VAIEFMDRPAIE-ICEAFAQAGYPLDVEA----LLIVEVEGSEAEMDATL 306
                      A E + R +++ + +    +  PL   A    LL +   G+ A++ A L
Sbjct: 239 RAQARFDARLTAFELISRQSLDLVLQHIPGSRQPLAAPAPWQVLLELADGGAWADLQADL 298

Query: 307 AGII--EIAR---RHGVMTIRESQSALEAALIWKGRKSAFGATGRIADYICMDGTVPLSQ 361
              I  E+A    + GV+   E+Q    A  +W  R++   A       I  D +VP+S+
Sbjct: 299 EDFIGGEMADGRVQDGVLAQNETQ----ARQLWALRENISEAQKIEGLSIKHDISVPVSR 354

Query: 362 LSHVLRRTGEIVAGY--GLRVANVFHAGDGNMHPLILYNINDPEE------AARAEAAGN 413
           +   L   G  +A    G+RV    HAGDGN+H    YN++  +        A    A  
Sbjct: 355 IPEFLDLAGTALAAAFPGVRVVAFGHAGDGNLH----YNLSKAQRQDNDTFIAATPQANR 410

Query: 414 DILKLCVEAGGCLTGEHGVGIEKRDLMLHQYSRADLGQQMAARAAFDPQWLMNPSKV 470
            +  L    GG ++ EHG+G  KR+ ++       L      +++ DP+ LMNP K+
Sbjct: 411 IVHDLVARLGGSISAEHGIGQLKREELVRYKDPVGLDLMRCIKSSLDPRGLMNPGKI 467


Lambda     K      H
   0.320    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 590
Number of extensions: 36
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 479
Length of database: 468
Length adjustment: 33
Effective length of query: 446
Effective length of database: 435
Effective search space:   194010
Effective search space used:   194010
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory