Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 3/3) (EC 1.3.1.110) (characterized)
to candidate Dsui_3150 Dsui_3150 electron transfer flavoprotein, beta subunit
Query= BRENDA::H6LBB0 (264 letters) >FitnessBrowser__PS:Dsui_3150 Length = 294 Score = 166 bits (421), Expect = 4e-46 Identities = 96/247 (38%), Positives = 140/247 (56%), Gaps = 12/247 (4%) Query: 1 MKILVCIKQVPGTSNVEVDPETGVLIRDGVESKLNPYDLFGLETAFRLKEQLGGTITTLS 60 M I+VCIKQVP ++ + V P T ++R GV + +NPYDLF +E A LK+QLGG +T L+ Sbjct: 1 MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPAIINPYDLFAIEAALALKDQLGGKVTVLT 60 Query: 61 MGPMQSKEVLMESFYMGADEGCLLSDRKFGGADVVATSYTLAQGTKRLGD---FDLIICG 117 MGP Q++ L ++ G DE L++D+ F GAD +ATSY LA K L DL+ G Sbjct: 61 MGPPQAEPALRKALSYGCDEAVLVTDKLFAGADTLATSYVLASAIKTLHQETPVDLVFTG 120 Query: 118 KQTTDGDTAQVGPEMAEFLGIPHVTNVIKILAADE--KGLTLQMNMEESLEIQRVPYPCL 175 KQT DGDTAQVGP +A+ L + +T V +I++ D+ + ++ E +++ P L Sbjct: 121 KQTIDGDTAQVGPGVAKRLELELLTYVSRIVSVDQAANSIRVERRAEGGVQVLETRLPAL 180 Query: 176 ITV---DKDIYTPRLPSYKRKLDISKNPEIKILTLKDMYDTNEKKYGLSGSPTQVERIFP 232 IT+ +I P R + E+++ + KK GL GSPT V R+F Sbjct: 181 ITMLEGSNEIRFGSAPDMFR----AARAEVRVWDRNAAGIEDIKKVGLKGSPTIVSRVFV 236 Query: 233 PESNVEK 239 P +K Sbjct: 237 PSPRAQK 243 Lambda K H 0.316 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 294 Length adjustment: 25 Effective length of query: 239 Effective length of database: 269 Effective search space: 64291 Effective search space used: 64291 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory