Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate Dsui_1003 Dsui_1003 phosphoribosylglycinamide formyltransferase 2
Query= SwissProt::P33221 (392 letters) >FitnessBrowser__PS:Dsui_1003 Length = 410 Score = 451 bits (1159), Expect = e-131 Identities = 248/398 (62%), Positives = 288/398 (72%), Gaps = 14/398 (3%) Query: 4 LGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLD 63 +GT L P+AT+VMLLG+GELGKEV I QRLGVEVIAVDRYADAP M VAHRSHVI+M D Sbjct: 3 IGTPLSPSATKVMLLGAGELGKEVIIALQRLGVEVIAVDRYADAPGMQVAHRSHVISMTD 62 Query: 64 GDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGL-NVVPCARATKLTMNREGIRRLAA 122 G ALRR++ELEKPH +VPEIEAIATD L+++E EGL V+P A A KLTMNREGIRRLAA Sbjct: 63 GAALRRLIELEKPHLVVPEIEAIATDTLVEIEAEGLAQVIPTALAAKLTMNREGIRRLAA 122 Query: 123 EELQLPTSTYRFADSESLFREAV------ADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQ 176 EEL LPTS YRFADS + + A+ IGYPC+VKPVMSSSGKGQ+ ++ + + Sbjct: 123 EELGLPTSPYRFADSLAELQAAIDGTGEEKGIGYPCVVKPVMSSSGKGQSLLKGPADVEK 182 Query: 177 AWKYAQQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDG-----VHFCAPVGHRQEDGDYR 231 AW +AQ GGR RVIVEG VKFD+EIT LTV AV FC P+GH Q DGDY Sbjct: 183 AWNHAQAGGRVQQSRVIVEGFVKFDYEITQLTVRAVGSSGQVETFFCEPIGHIQVDGDYV 242 Query: 232 ESWQPQQMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVT 291 ESWQPQ MS A E+++EIA KV LGG G+FGVELF+ GD+V FSEVSPRPHDTG+VT Sbjct: 243 ESWQPQPMSEAAREKSREIAEKVTSNLGGRGIFGVELFIKGDQVWFSEVSPRPHDTGLVT 302 Query: 292 LISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGA-DLQI 350 L SQ LSEF LH RA LGLPV + P ASAVI L Q V ++ V A+ + Sbjct: 303 LTSQRLSEFELHARAILGLPVDASLR-TPGASAVIYGGLEEQGVAYEGVAEALQVPTADL 361 Query: 351 RLFGKPEIDGSRRLGVALATAESVVDAIERAKHAAGQV 388 RLFGKPE RR+GVALAT S+ A +RA AA +V Sbjct: 362 RLFGKPESFKKRRMGVALATGGSIEQARQRASLAASRV 399 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 410 Length adjustment: 31 Effective length of query: 361 Effective length of database: 379 Effective search space: 136819 Effective search space used: 136819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory