Align Lactate utilization protein A (characterized)
to candidate Dsui_1582 Dsui_1582 Fe-S oxidoreductase
Query= SwissProt::O07020 (238 letters) >FitnessBrowser__PS:Dsui_1582 Length = 242 Score = 220 bits (561), Expect = 2e-62 Identities = 114/237 (48%), Positives = 151/237 (63%), Gaps = 2/237 (0%) Query: 1 MKVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVHDAKKAMK 60 M+V+LFVTCL D+ + NV A ++LL+ GC V+ PE Q CCGQPAYNSG A + Sbjct: 1 MRVALFVTCLADLMRPNVAFAALKLLKLAGCTVEVPETQTCCGQPAYNSGDRATALTLAR 60 Query: 61 RMIETFQDSEYVVSPSGSCTTMFR-EYPHLFQDDPKWADKAKKLADKTYELTDFIVNVLG 119 ++I+ F+ EYVV PSGSC M R Y L +DDP +AKKLA TYELTDF+VNV Sbjct: 61 KVIDEFEGYEYVVLPSGSCAGMIRAHYEELCKDDPALLARAKKLAACTYELTDFLVNVAK 120 Query: 120 VEDVGATLHTKATLHTSCHMTRLLGVRKEPMKLLSHVKGLQFTELPGKHNCCGFGGTFSV 179 +E V T H SC R LG++++P +LL + ++ E+ CCGFGGTFS+ Sbjct: 121 LESVPGDFAGSITYHDSCSGLRELGIKQQPRQLLGKMGQVEIKEMSEAETCCGFGGTFSL 180 Query: 180 KMAQISEQMVDEKVECVEETGAEVLIGADCGCLMNIGGRLGRK-DKNVKVMHIAEVL 235 K IS ++ D K E TGA+ ++G D GCL+NI GRL RK D+ +V+H+AEVL Sbjct: 181 KFGDISTKLADNKCENACATGADAIVGGDLGCLLNIEGRLRRKGDRKTQVLHVAEVL 237 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 242 Length adjustment: 23 Effective length of query: 215 Effective length of database: 219 Effective search space: 47085 Effective search space used: 47085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory