Align Lactate utilization protein B (characterized)
to candidate Dsui_1583 Dsui_1583 (4Fe-4S) cluster-containing protein
Query= SwissProt::O07021 (479 letters) >FitnessBrowser__PS:Dsui_1583 Length = 470 Score = 403 bits (1036), Expect = e-117 Identities = 205/468 (43%), Positives = 297/468 (63%), Gaps = 1/468 (0%) Query: 3 MKIGTDAFKERVSQGIDNEFMRGAVSGAQERLRTRRLEAAEELGNWEEWRSLSEEIRQHV 62 M+I ++ FK R + + N ++ A+ Q + R AA E G++E R +IR Sbjct: 1 MEIHSNDFKARAREALANPNLQKALKLVQVKFVPGRAAAAAEFGDFETLRDAGRDIRNRA 60 Query: 63 LENLDFYLGQLAENVAKRGGHVYFAKTAEEASSYIRDVIQKKNGKKIVKSKSMVTEEINL 122 LENLD +L + + +RG V++A+ A EA++ I + Q KK+VKSKSMV+EE L Sbjct: 61 LENLDLWLERFEQEATRRGAQVHWARDAAEANAIIVGIAQANGVKKVVKSKSMVSEECGL 120 Query: 123 NEVLEKEGCEVVETDLGEYILQIDDHDPPSHIVAPALHKNKEQIRDVFKERLDYQHTEKP 182 N+ LE G VETDLGEYILQI+DH+PPSHIVAP +HK ++++ D+F + TE Sbjct: 121 NDALEAAGVTPVETDLGEYILQINDHEPPSHIVAPVIHKTRDEVSDLFHAKHGKPRTEDI 180 Query: 183 EELVMHARAILRKKFLEADIGITGCNFAIADTGSVSLVTNEGNGRLVSTLPKTQITVMGM 242 L AR ILR FL AD+GI+G NF +A+TGS +VTNEGNGRL +T+P+ + + G+ Sbjct: 181 GALCREAREILRPHFLSADMGISGANFLVAETGSTVIVTNEGNGRLCTTVPRIHVALTGI 240 Query: 243 ERIVPSFSEFEVLVSMLTRSAVGQRLTSYITALTGPKLEGEVDGPEEFHLVIVDNGRSNI 302 E++VP+ + VL+ +L RSA GQ +T+Y++ TG G+ DGPE+FH+V++DNGRS + Sbjct: 241 EKVVPTLEDLSVLLRLLPRSATGQPITNYVSMNTGVAGSGDSDGPEQFHIVLLDNGRSRV 300 Query: 303 LGTEFQSVLQCIRCAACINVCPVYRHVGGHSYGSIYSGPIGAVLSPLLGGYDDYKELPYA 362 LG+E + +L+CIRC AC+N CPVY+ VGGH+YG +Y GP+G+VL+P G + ELP+ Sbjct: 301 LGSELKEMLRCIRCGACMNHCPVYQAVGGHAYGWVYPGPMGSVLTPSYAGMEHAHELPHT 360 Query: 363 SSLCAACSEACPVKIPLHELLLKHRQNIVEKEGRAPISEKLAMKAFGLGASSLSLYKMGS 422 ++ C CS CPV+IPL EL+ K R+ VE G P E+L++K +G AS LY +G+ Sbjct: 361 ATGCGQCSAVCPVRIPLPELMRKEREMQVE-AGLRPWQERLSLKLWGWSASQSWLYGIGT 419 Query: 423 KWAPAAMTPFTEDEKISKGPGPLKNWTQIRDFPAPHKSRFRDWFADRE 470 A + +++ WT RDFPAP FR+ + R+ Sbjct: 420 AIAARFLKRLGGADQLIHRLPLGGGWTDGRDFPAPAGKTFRELYRARK 467 Lambda K H 0.316 0.134 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 470 Length adjustment: 33 Effective length of query: 446 Effective length of database: 437 Effective search space: 194902 Effective search space used: 194902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory