Align LUD_dom domain-containing protein (characterized, see rationale)
to candidate Dsui_1584 Dsui_1584 hypothetical protein
Query= uniprot:A0A0C4YFN9 (234 letters) >FitnessBrowser__PS:Dsui_1584 Length = 217 Score = 69.3 bits (168), Expect = 6e-17 Identities = 55/146 (37%), Positives = 74/146 (50%), Gaps = 16/146 (10%) Query: 91 PAAEQGAALMRALPA------SVAPLSYARP---IEAWKAELFDTVDAGFTVARSGIAAT 141 PAA + R LP S+A ++A +EA + D V G T +A T Sbjct: 75 PAAAAAYLIARELPTRAVCWPSLADQAWAGAGLQVEARPSRGDDLV--GITSTFCAVADT 132 Query: 142 GTLVLAPDAQTPRTVSLVPPLHIALVYAETLHP---DLHCAARAERWSAGMPTNLVLVSG 198 GTL+L A T SL+P HIA+V E + P D RAE+ A N V SG Sbjct: 133 GTLMLLSGADTHAATSLLPETHIAVVPVERVVPLMEDGFALLRAEKGEAPRAVNFV--SG 190 Query: 199 PSKTSDIQQTLAYGAHGPRELWVIIV 224 PS+T+DI+QT+ GAHGP + +I+V Sbjct: 191 PSRTADIEQTVTLGAHGPYRVHLILV 216 Lambda K H 0.317 0.127 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 234 Length of database: 217 Length adjustment: 22 Effective length of query: 212 Effective length of database: 195 Effective search space: 41340 Effective search space used: 41340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory