Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate Dsui_1833 Dsui_1833 nitrate transport ATP-binding subunits C and D
Query= reanno::Smeli:SMc02869 (352 letters) >FitnessBrowser__PS:Dsui_1833 Length = 266 Score = 144 bits (364), Expect = 2e-39 Identities = 85/232 (36%), Positives = 137/232 (59%), Gaps = 11/232 (4%) Query: 20 LQLKTIRKAF----GSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGS 75 +Q++ + + F G L+ +DL ++ GEF+ +G SGCGKSTLL IAGL T G+ Sbjct: 5 VQIEAVGQTFDTKKGKFVALRDVDLSIRQGEFIALIGHSGCGKSTLLNLIAGLTRPTDGA 64 Query: 76 VQIDGVEVGHVAPAKRGIAMVFQSYALYPHLTVKDNMGLGLKQ---AGVPKAEIEEKVAK 132 + DG E+ P +RG+ VFQ+++L P LT DN+ L +++ A KA+++++ Sbjct: 65 LICDGREIAGPGP-ERGV--VFQNHSLLPWLTCFDNVYLAVERVFAAKEGKAKLKQRTHD 121 Query: 133 AAGMLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEI 192 A ++ L + P E+SGG +QRV I RA+ +PK+ L DEP LDA R + E+ Sbjct: 122 ALALVGLTHAETKFPHEISGGMKQRVGIARALSMQPKVLLMDEPFGALDALTRAKLQDEL 181 Query: 193 ARLHRSLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMEL-YNRPAN 243 ++ + +AT++ VTHD EA+ L+D+IV++ G +G + + RP N Sbjct: 182 MKICDATQATVVMVTHDVDEAVLLSDRIVMMTNGPAATIGEILSVDLPRPRN 233 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 266 Length adjustment: 27 Effective length of query: 325 Effective length of database: 239 Effective search space: 77675 Effective search space used: 77675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory