Align putative transporter, required for glycine and L-alanine utilization (characterized)
to candidate Dsui_2676 Dsui_2676 putative membrane protein
Query= reanno::ANA3:7023996 (213 letters) >FitnessBrowser__PS:Dsui_2676 Length = 206 Score = 128 bits (322), Expect = 7e-35 Identities = 83/198 (41%), Positives = 114/198 (57%), Gaps = 5/198 (2%) Query: 9 LLWLIGILAEAM---TGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPLIWVEN 65 LL+ +G++A A+ TG A RK MDL G V++ AT +GGGT+RD+LL + WV + Sbjct: 6 LLYWVGLVAVAVGAATGVFEAERKGMDLVGTVMVAVATGLGGGTVRDLLLDRN-VFWVVD 64 Query: 66 VHYLLAIAFASLLTVAIAPVMRYLSKLFLAIDALGLAVFSIVGAQKTLMLGFSPTIAVVM 125 YL+ +LT I +LFL DAL LA+F+++G Q L +A +M Sbjct: 65 QTYLITAFATGILTFFIVRRRPISPRLFLYPDALALALFAVLGTQAALHWHAPWLVASLM 124 Query: 126 GLVTGVFGGVIRDILCNQVPLIF-KKELYAVISLFTAGLYITLNAYQLAEWINLVVCLTL 184 G++TGVFGGV+RDI CNQVPLIF ELYA +L L I L A ++ + L Sbjct: 125 GVITGVFGGVLRDIFCNQVPLIFLPGELYASAALAGCLLLIGLQALGVSPVWAAWLAAAL 184 Query: 185 GFSLRMLALRYHWSMPTF 202 F LR A+ + S+PTF Sbjct: 185 IFGLRWAAIVFKISLPTF 202 Score = 28.1 bits (61), Expect = 1e-04 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query: 89 LSKLFLAIDALGLAVFSIVGAQKTLMLGFSPTIAVVMGLVTGVFGGVIRDILCNQVPLIF 148 L+ L + + +AV + G + G V++ + TG+ GG +RD+L ++ Sbjct: 3 LADLLYWVGLVAVAVGAATGVFEAERKGMDLVGTVMVAVATGLGGGTVRDLLLDRNVFWV 62 Query: 149 KKELYAVISLFTAGL 163 + Y +I+ F G+ Sbjct: 63 VDQTY-LITAFATGI 76 Lambda K H 0.330 0.143 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 213 Length of database: 206 Length adjustment: 21 Effective length of query: 192 Effective length of database: 185 Effective search space: 35520 Effective search space used: 35520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory