Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate Dsui_2943 Dsui_2943 ABC-type spermidine/putrescine transport system, ATPase component
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__PS:Dsui_2943 Length = 356 Score = 190 bits (483), Expect = 5e-53 Identities = 103/246 (41%), Positives = 148/246 (60%), Gaps = 13/246 (5%) Query: 1 MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETV 60 MA L L DV + Y G V+ I I+ G L+GPSGCGK+T LR +AG E + Sbjct: 1 MAHLELADVMQRY-----GAHTVVDGIGFHIEAGVIACLLGPSGCGKTTLLRCIAGFEDI 55 Query: 61 TEGELRLEDRVLNG----VSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEI 116 G + L+ +++ ++ + R I MVFQ YAL+PH +V N++FGL+ G E Sbjct: 56 AAGSIALDGELVSRPGFKLAPEQRRIGMVFQDYALFPHLTVADNIAFGLKTKGG----ER 111 Query: 117 RQRVEETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRA 176 +QRV D++G++ ++ P +LSGGQQQRVAL RA+ P + L+DEP SNLD LR Sbjct: 112 QQRVAAMLDLVGLAGQGEKYPHELSGGQQQRVALARALAPAPRLVLLDEPFSNLDVDLRE 171 Query: 177 EMRTELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFV 236 + E++ + + G T + VTHDQ EA M D + V+ +G +QQ TP + YH+P N FV Sbjct: 172 RLSLEVREILKKAGTTAILVTHDQHEAFAMADEIGVMHEGRIQQWDTPYNLYHQPANRFV 231 Query: 237 AGFIGE 242 A F+G+ Sbjct: 232 ADFVGQ 237 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 356 Length adjustment: 30 Effective length of query: 353 Effective length of database: 326 Effective search space: 115078 Effective search space used: 115078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory