Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate Dsui_3464 Dsui_3464 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__PS:Dsui_3464 Length = 263 Score = 119 bits (297), Expect = 8e-32 Identities = 78/220 (35%), Positives = 124/220 (56%), Gaps = 18/220 (8%) Query: 1 MSDLLEIRDVHKSF----GAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKP 56 MSD+L I+DV K F G V AL +++ + +GE V LLG +G GKSTL+ ++G+ P Sbjct: 1 MSDIL-IKDVQKVFKTPGGDVTALKDINLTVKQGEFVCLLGPSGCGKSTLLNAVAGFQPP 59 Query: 57 DRGDLVFEGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKK 116 G++V EGKK++ P+ ++Q+ AL P + + NI ++ K K + Sbjct: 60 SAGEIVIEGKKILTPGPDRG------MVFQEYALFPWMTVAQNIAFGLQIQKK---EKAE 110 Query: 117 MMEESKKLLDSLQIRIPDINMKV-ENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVV 175 + +LLD L ++ D + ++LSGG RQ VA+AR + + ++LMDEP AL + Sbjct: 111 IDLTVNQLLDLLHLK--DFRDRFPKDLSGGMRQRVAIARVLALDSPIMLMDEPFGALDAL 168 Query: 176 EARKVL-ELARNLKKKGLGVLIITHNIIQGYEVADRIYVL 214 R + EL R +K +L +TH+I + +ADRI V+ Sbjct: 169 TRRNLQDELLRIWEKLNKTILFVTHSIEESIYLADRIVVM 208 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 263 Length adjustment: 24 Effective length of query: 227 Effective length of database: 239 Effective search space: 54253 Effective search space used: 54253 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory