Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate Dsui_2058 Dsui_2058 ABC-type branched-chain amino acid transport systems, ATPase component
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__PS:Dsui_2058 Length = 260 Score = 201 bits (511), Expect = 1e-56 Identities = 122/270 (45%), Positives = 157/270 (58%), Gaps = 12/270 (4%) Query: 7 NTMSDDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKP 66 N LL + ++ FGGL + D SFE G I LIGPNGAGKTTVFN ITG P Sbjct: 2 NAPQQPNLLSIRNVGKHFGGLHVLQDVSFEVPAGSIYGLIGPNGAGKTTVFNLITGLLTP 61 Query: 67 TMGMITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMK 126 + G I F ++ L L RIT + +ARTFQNIR+F + +LEN++V H+ L Sbjct: 62 SAGQIDFQGQT-----LIGLEPHRITHQG-IARTFQNIRIFKEMDLLENVMVGMHDHL-- 113 Query: 127 ASGYTILGLIGVGPYKREA-AEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARA 185 Y G+ P R A +A E A L L +AD A +L YG QR+LE ARA Sbjct: 114 --NYGGFGIFLNSPACRAAEKKARERALELLSWVGLDHKADMLADNLSYGDQRKLEFARA 171 Query: 186 MCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVL 245 + T P+LL LDEP AG+NP E L + +IR G + +IEHDM VM + D + VL Sbjct: 172 LATEPKLLLLDEPVAGMNPSEKTILMEEINNIR-NRGYGVFMIEHDMRFVMGLCDRIAVL 230 Query: 246 EYGQKISDGTPDHVKNDPRVIAAYLGVEDE 275 +G+ I++GTPD V+N+P VI AYLG EDE Sbjct: 231 NFGRIIAEGTPDEVRNNPDVIEAYLGKEDE 260 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 260 Length adjustment: 25 Effective length of query: 267 Effective length of database: 235 Effective search space: 62745 Effective search space used: 62745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory