Align Glutamate/aspartate import permease protein GltJ (characterized)
to candidate Dsui_0636 Dsui_0636 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= SwissProt::P0AER3 (246 letters) >FitnessBrowser__PS:Dsui_0636 Length = 245 Score = 317 bits (813), Expect = 1e-91 Identities = 149/246 (60%), Positives = 196/246 (79%), Gaps = 1/246 (0%) Query: 1 MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNRF 60 M+ +WNW +FL P G TTYLGW+++G Q T+ALS+ AW+IA +VGS G+LRTVPNR+ Sbjct: 1 MNYNWNWSVFLTPVPSGETTYLGWLFTGLQWTVALSLSAWVIALVVGSIVGVLRTVPNRW 60 Query: 61 LSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLGL 120 LSG +YVE FRNVPL+VQ F+WY V+PELLP +G +K + DP +Q FL++MLCLGL Sbjct: 61 LSGFAAVYVECFRNVPLLVQLFSWYFVLPELLPPALGNAYK-QSDPLLQQFLAAMLCLGL 119 Query: 121 FTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLV 180 FTAARV EQVRA I+SLPRGQ+NA LAMG TL Q YR+VLLP A+R+IVPP+TSE +N+ Sbjct: 120 FTAARVAEQVRAGIESLPRGQRNAGLAMGFTLAQVYRHVLLPMAFRIIVPPLTSEFLNIF 179 Query: 181 KNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLINAFIMLVMTLVERKVRLP 240 KNSA+A+TIGL++++ QA +L+DY+A +E+F A+TL YV IN +M +M +E KVR+P Sbjct: 180 KNSAVATTIGLIELSRQAQQLVDYTAQPYEAFIAVTLLYVCINVTVMFLMRRLEEKVRVP 239 Query: 241 GNMGGK 246 G +GGK Sbjct: 240 GFIGGK 245 Lambda K H 0.328 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 245 Length adjustment: 24 Effective length of query: 222 Effective length of database: 221 Effective search space: 49062 Effective search space used: 49062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory