Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate Dsui_0637 Dsui_0637 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= uniprot:Q31RP0 (377 letters) >FitnessBrowser__PS:Dsui_0637 Length = 224 Score = 84.0 bits (206), Expect = 4e-21 Identities = 58/165 (35%), Positives = 88/165 (53%), Gaps = 7/165 (4%) Query: 208 LYGAIAVVTVLMLLTQLSWPQQLQP--GQIRGGLRLSLEFTALLLGLVAYTGAFITEIIR 265 L+ ++ +V V++ L PQ L+ GQ G +RL + L+ + A+ +EIIR Sbjct: 62 LFRSVPLVMVILWF-YLIVPQALKGLFGQDIGDIRL----VSALVAFALFEAAYYSEIIR 116 Query: 266 GGILSVPAGQWEAAAALGLTRSQTLWQIVVPQALRVIVPSLNSQYVGFAKNSSLAIAVGY 325 GI SVP GQ A ALGLT QT+ +V+PQA R ++P L +Q + +++SL +G Sbjct: 117 AGIQSVPKGQVAAGLALGLTPGQTMRLVVLPQAFRNMIPLLLTQAIILFQDTSLVYVIGL 176 Query: 326 PDLYATAQTTLNQTGRPVEVFLILMLTYLAINAVISAGMNGLQQR 370 D + TA ++ GR VE+ L Y I +S + LQ R Sbjct: 177 SDFFGTAYKVGDRDGRLVELLLFAGAAYFVICFTVSRLVKHLQAR 221 Score = 41.2 bits (95), Expect = 3e-08 Identities = 23/62 (37%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 85 GLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLLQLIVWYFP 144 GL+ +L V +++ GTL VA S N LL L+ GYV + R+ PL++ +I+W++ Sbjct: 19 GLLVTLEVTLTAIVVGIGWGTLLAVARLSSNRLLSFLAAGYVNLFRSVPLVM-VILWFYL 77 Query: 145 IL 146 I+ Sbjct: 78 IV 79 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 224 Length adjustment: 26 Effective length of query: 351 Effective length of database: 198 Effective search space: 69498 Effective search space used: 69498 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory